LOADING...
   ZP_03460274.1;SP14019C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_03460274.1    SP14019C            JCSG 417670 PDB Deposition 13-JUN-20              PDB id: 4lba

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_03460274.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides eggerthii dsm 20697
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4LBA; Identical; 07-AUG-13; CONJUGATIVE TRANSPOSON LIPOPROTEIN;
DR PDB; 2L7Q; Highly similar; 29-DEC-10; CONSERVED PROTEIN FOUND IN CONJUGATE TRANSPOSON;
DR PDB; 2L3B; Highly similar; 10-NOV-10; CONSERVED PROTEIN FOUND IN CONJUGATE TRANSPOSON;
DR FFAS; 407437; Fold and function assignment.
DR TVPC; ZP_03460274.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_03460274.1; Ortholog view popup.
DR TPM; ZP_03460274.1; Target PDB monitor.
DR FSS; ZP_03460274.1; Target function coverage.
PROPERTY Residues: 167 aa
Molecule Weight: 19167.76 Dalton
Isoelectric Point: 4.67
Extinction Coefficient: 10430
Gravy Index: -.24
Number of Met residues: 5
Percentage of Met residues: 2.99 %
Number of Cys residues: 3
Percentage of Cys residues: 1.80 %
SEQUENCE  amino acids 167 aa
>ZP_03460274.1  gi|218131470|ref|ZP_03460274.1| hypothetical protein BACEGG_03088 [Bacteroides eggerthii DSM 20697]
MNILNNRNKRTSIFKAVALCLIAAMSFTLVSCDDDMDIQQSYPFTVEVMPVPNKVVKGQT
VEIRCELKKEGDFSGTLYTIRYFQFEGEGSLKMDNGITFLPNDRYLLENEKFRLYYTAAG
DEAHNFIVVVEDNFSNSYELEFDFNNRNVKDDDLTIVPIGNFSPLLK

CDS  cDNA 504 bp
   1 atgaacatac tgaacaacag aaacaagaga acatcaatat tcaaggcagt ggcgttatgc    60
  61 ctgatagccg ccatgtcatt caccctcgtg tcatgtgacg atgacatgga catccagcag   120
 121 tcctatccct tcacggtgga ggtcatgccc gtgccgaaca aggtagtaaa ggggcagaca   180
 181 gtggaaatcc gctgtgaact gaaaaaggag ggcgactttt cgggtacgct ctataccatc   240
 241 cgctatttcc agttcgaggg ggaaggctcg ctcaaaatgg ataacggcat caccttcctg   300
 301 cctaacgacc gctacctgct ggagaacgaa aaattccgcc tgtactacac ggcggcgggt   360
 361 gatgaggcgc ataatttcat cgtggtggtg gaggataact ttagcaactc ctacgaactg   420
 421 gaatttgact tcaacaacag gaatgtaaag gacgacgatc ttaccatcgt tcccatcggc   480
 481 aacttcagcc ccttgttgaa atga   504
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu