LOADING...
   ZP_03459111.1;SP5709A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_03459111.1    SP5709A            JCSG 417716 PDB Deposition 13-JUN-17              PDB id: 4l8j

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_03459111.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides eggerthii dsm 20697
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4L8J; Identical; 03-JUL-13; PUTATIVE EFFLUX TRANSPORTER;
DR PDB; 4DK1; Highly similar; 07-MAR-12; PUTATIVE MACA, MULTIDRUG RESISTANCE PROTEIN MEXA;
DR FFAS; 407533; Fold and function assignment.
DR TVPC; ZP_03459111.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_03459111.1; Ortholog view popup.
DR TPM; ZP_03459111.1; Target PDB monitor.
DR FSS; ZP_03459111.1; Target function coverage.
PROPERTY Residues: 350 aa
Molecule Weight: 39098.9 Dalton
Isoelectric Point: 8.88
Extinction Coefficient: 29340
Gravy Index: -.17
Number of Met residues: 6
Percentage of Met residues: 1.71 %
Number of Cys residues: 2
Percentage of Cys residues: 0.57 %
SEQUENCE  amino acids 350 aa
>ZP_03459111.1  gi|218130307|ref|ZP_03459111.1| hypothetical protein BACEGG_01895 [Bacteroides eggerthii DSM 20697]
MKKMYLFALAMTFLITSCGQKKGEDTALVRPVKTATVSSQSVILKDFSGMVEAVEYVKLA
FRVSGQIINLPVVEGQRVKKGQLIAAIDPRDISLQYAADKAAYETAAAQVERNKRLLGRQ
AISLQEYEISVANYQKAKSAYELSTNNMRDTKLLAPFDGSIETRLVENYQRVNSGEGIVR
LVNTRKLRIKFTVPDDYLYLLRAKDATFKVEFDTYKGTVFNARLEEYLDISTDGTGIPVT
IIIDDAAFDRTIYDVKPGFTCNIRLASDIAPFIEEKLMNVPLSAVFGDSENKNTYVWIVK
DNKVNRREVTVYSPTGEANLLISKGLKPGETVVTAGVYQLVEGQRIKEVK

CDS  cDNA 1053 bp
   1 atgaaaaaaa tgtacctgtt cgccctggcg atgacgtttc tcatcacgtc ctgcgggcaa    60
  61 aaaaaggggg aagatactgc cctcgtgcga cctgtgaaaa ccgctaccgt cagttcacag   120
 121 tcagtgatcc ttaaagactt ctccggcatg gtggaagcag tggaatatgt gaagctggct   180
 181 tttagggtca gtggacagat catcaacctt ccggttgtgg aaggacaaag ggtcaagaaa   240
 241 gggcagctca ttgccgctat cgacccgcgt gacatttcct tgcaatatgc cgccgacaag   300
 301 gctgcctatg aaactgccgc cgcgcaggtt gagcgcaaca aacggttact gggacgtcag   360
 361 gccatctccc tgcaagaata tgaaatcagt gtagccaatt atcagaaagc aaaatccgct   420
 421 tacgagctat ccaccaacaa tatgcgggat acgaaactgc tggctccttt cgacggttct   480
 481 atcgaaacac gtctggtaga gaactatcag cgcgtcaatt cgggagaggg gatcgtacgg   540
 541 ctggtcaata ctcggaaact gcgtatcaaa tttaccgtac ccgacgatta cctttacctg   600
 601 cttcgtgcca aagacgctac attcaaagta gaattcgaca cttacaaggg tacggtattc   660
 661 aatgccagac tggaagagta tcttgacata tcaaccgacg gtacaggtat tccggtaaca   720
 721 atcatcatcg acgatgccgc ttttgaccgc accatatatg atgtgaagcc gggattcacc   780
 781 tgtaacatcc gcctggcatc ggatattgct cctttcatag aagaaaaact gatgaatgtg   840
 841 ccgctaagcg ccgtattcgg tgacagcgaa aacaagaaca cctatgtatg gatagtgaaa   900
 901 gacaacaagg tgaaccgtcg cgaagtaacc gtatattcac ctaccggaga ggctaatctt   960
 961 ctcatatcca aaggtctgaa accaggtgaa accgttgtca cagccggagt gtaccaattg  1020
1021 gtggaaggac agagaataaa agaggtaaaa tga  1053
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu