LOADING...
   ZP_03458979.1;SP8207C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_03458979.1    SP8207C            JCSG 417719 PDB Deposition 15-FEB-26              PDB id: 4ygu

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_03458979.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides eggerthii dsm 20697
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4YGU; Identical; 11-MAR-15; PUTATIVE ADHESIN;
DR PDB; 3PET; Highly similar; 09-FEB-11; PUTATIVE ADHESIN;
DR FFAS; 407536; Fold and function assignment.
DR TVPC; ZP_03458979.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_03458979.1; Ortholog view popup.
DR TPM; ZP_03458979.1; Target PDB monitor.
DR FSS; ZP_03458979.1; Target function coverage.
PROPERTY Residues: 207 aa
Molecule Weight: 22149.1 Dalton
Isoelectric Point: 6.74
Extinction Coefficient: 9970
Gravy Index: -.06
Number of Met residues: 3
Percentage of Met residues: 1.45 %
Number of Cys residues: 4
Percentage of Cys residues: 1.93 %
SEQUENCE  amino acids 207 aa
>ZP_03458979.1  gi|218130175|ref|ZP_03458979.1| hypothetical protein BACEGG_01763 [Bacteroides eggerthii DSM 20697]
MRTDVAGVIIALVLAFAGMLSVCAQDAKESEVRKVDAFSSIEITSVGTIHFTQSDTYSFR
IEGREKYVKNTETTVKDGRLLIGFKDKKNKSRRNQKDGVTIWISAPDLKEVEFTGVGEFN
CEKPLKLDEVSFEVKGVGEVNVADLTCNVLKVALRGVGSADIHVVCDYLSAQMGGVGSVT
LSGSAGRADISKGGIGGVNTDNLKIGR

CDS  cDNA 624 bp
   1 atgagaactg atgtagcagg tgttatcatt gcattggtat tggcctttgc aggtatgctg    60
  61 agtgtttgtg cacaagatgc aaaagaaagt gaagtgcgta aagtggatgc tttctcgtca   120
 121 attgagataa cctctgtggg gacaattcat tttacacaga gtgacactta ttctttcagg   180
 181 attgaaggca gggagaagta cgtgaagaat acggaaacca cagtgaagga cggccgtttg   240
 241 ctgataggct tcaaggacaa gaaaaacaag agtaggagaa atcagaaaga cggcgtgact   300
 301 atctggattt cggctcccga cttgaaggag gtggagttta ccggtgtagg ggaattcaat   360
 361 tgtgagaagc ccttgaaact cgatgaagtg tcatttgagg taaaaggcgt gggtgaagtg   420
 421 aatgttgccg atttgacgtg taacgtgttg aaagttgctt tgcgcggagt aggtagcgcc   480
 481 gatattcatg tagtctgcga ttatttgtct gcccaaatgg gtggtgtggg cagcgtcact   540
 541 ttgagcggaa gcgccggacg cgctgatatt tccaaaggag gcataggagg cgtaaataca   600
 601 gataatttaa aaataggccg ttga   624
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu