LOADING...
   ZP_03458806.1;SP13538B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_03458806.1    SP13538B            JCSG 417708 PDB Deposition 15-JUN-10              PDB id: 5byp

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_03458806.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides eggerthii dsm 20697
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4QRL; Highly similar; 27-AUG-14; HYPOTHETICAL PROTEIN;
DR FFAS; 407520; Fold and function assignment.
DR TVPC; ZP_03458806.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_03458806.1; Ortholog view popup.
DR TPM; ZP_03458806.1; Target PDB monitor.
DR FSS; ZP_03458806.1; Target function coverage.
PROPERTY Residues: 150 aa
Molecule Weight: 17245.67 Dalton
Isoelectric Point: 6.58
Extinction Coefficient: 39880
Gravy Index: -.55
Number of Met residues: 5
Percentage of Met residues: 3.33 %
Number of Cys residues: 3
Percentage of Cys residues: 2.00 %
SEQUENCE  amino acids 150 aa
>ZP_03458806.1  gi|218130002|ref|ZP_03458806.1| hypothetical protein BACEGG_01585 [Bacteroides eggerthii DSM 20697]
MKKLLNGTILLLLMCAVSGLTSCMNDGGSDWVGKWQLREYQYPDGKVQKVDSIFYGFQKG
SFLAYCMNKSGSYEGFYGYYKLKDDEISITLWPDNSSGNEAAHEELVNSASYKNFFGWGD
TGERTFKVEELTDKKMRLNYEGTKYVFRKY

CDS  cDNA 453 bp
   1 atgaaaaaat tgttgaatgg gacaattcta ttacttttga tgtgtgcagt atcgggattg    60
  61 acgtcttgta tgaatgacgg aggttccgat tgggttggaa aatggcagtt gcgtgaatat   120
 121 cagtatcccg acggtaaagt gcagaaagtg gacagcatct tttatggctt tcaaaaaggt   180
 181 agctttttgg catattgtat gaataaaagt ggaagctatg aaggttttta tggctattat   240
 241 aagttgaaag atgatgaaat ttctataact ttgtggccgg ataatagttc cggaaatgag   300
 301 gcagcgcacg aggaactggt gaattctgca agttataaga atttctttgg ctggggagat   360
 361 accggtgaaa ggacattcaa ggttgaagaa ctgaccgaca agaagatgcg attgaactat   420
 421 gagggaacga aatatgtttt ccgtaagtat tga   453
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu