LOADING...
   ZP_03458466.1;SP13795D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_03458466.1    SP13795D            JCSG 417679 PDB Deposition 13-JUN-06              PDB id: 4l3r

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_03458466.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides eggerthii dsm 20697
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4L3R; Identical; 10-JUL-13; UNCHARACTERIZED PROTEIN;
DR FFAS; 407453; Fold and function assignment.
DR TVPC; ZP_03458466.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_03458466.1; Ortholog view popup.
DR TPM; ZP_03458466.1; Target PDB monitor.
DR FSS; ZP_03458466.1; Target function coverage.
PROPERTY Residues: 172 aa
Molecule Weight: 19284.06 Dalton
Isoelectric Point: 6.84
Extinction Coefficient: 18450
Gravy Index: -.27
Number of Met residues: 6
Percentage of Met residues: 3.49 %
Number of Cys residues: 2
Percentage of Cys residues: 1.16 %
SEQUENCE  amino acids 172 aa
>ZP_03458466.1  gi|218129662|ref|ZP_03458466.1| hypothetical protein BACEGG_01241 [Bacteroides eggerthii DSM 20697]
MKKRINIKSIGYVLMMLTMLLGFSACNNEDDVMEIFNDKTWKLSRITTEKGKEQFYQGLW
SNEAEEKASRELLKITENFTLNFNCADVNGEVTGTVSAHAVKANISDAILKIDGKEHTIS
ISGKAYGSESDKLAKVFISGLFNVFKYEGDVHNLTLYFKDGNTTKVMGFTAR

CDS  cDNA 519 bp
   1 atgaaaaaga gaataaatat aaaatcaata ggctatgtcc tgatgatgct gaccatgtta    60
  61 cttggtttca gtgcttgcaa caacgaagac gacgtaatgg aaatcttcaa cgacaagact   120
 121 tggaaactga gccgcataac tactgaaaaa ggaaaggaac agttctatca aggtttgtgg   180
 181 agtaatgagg ctgaagagaa agccagcagg gaactgctca agataacaga aaatttcaca   240
 241 ttgaacttca actgtgccga tgtgaacggc gaggtgaccg gtacggtcag cgcccatgcc   300
 301 gtcaaagcaa acatcagcga cgccatcctg aaaatagacg gaaaggaaca caccataagc   360
 361 atcagtggga aagcctacgg cagtgaaagc gacaagctgg caaaagtatt catcagcggc   420
 421 ctgttcaatg ttttcaagta cgaaggggac gtgcacaacc tcaccctcta ctttaaagac   480
 481 ggaaatacaa caaaagtcat gggatttaca gcccgctaa   519
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu