LOADING...
   ZP_03312748.1;SP16521B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_03312748.1    SP16521B            JCSG 420514 PDB Deposition 13-NOV-12              PDB id: 4nkp

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_03312748.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMDesulfovibrio piger atcc 29098
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF03928; DUF336;
DR PDB; 4NKP; Identical; 11-DEC-13; PUTATIVE EXTRACELLULAR HEME-BINDING PROTEIN;
DR PDB; 4BMW; Highly similar; 25-SEP-13; EXTRACELLULAR HAEM-BINDING PROTEIN;
DR PDB; 3FPV; Highly similar; 20-JAN-09; EXTRACELLULAR HAEM-BINDING PROTEIN;
DR PDB; 3FPW; Highly similar; 20-JAN-09; EXTRACELLULAR HAEM-BINDING PROTEIN;
DR PDB; 2A2L; Highly similar; 28-JUN-05; UNKNOWN;
DR FFAS; 410532; Fold and function assignment.
DR TVPC; ZP_03312748.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_03312748.1; Ortholog view popup.
DR TPM; ZP_03312748.1; Target PDB monitor.
DR FSS; ZP_03312748.1; Target function coverage.
PROPERTY Residues: 169 aa
Molecule Weight: 17916.74 Dalton
Isoelectric Point: 6.37
Extinction Coefficient: 4470
Gravy Index: .23
Number of Met residues: 6
Percentage of Met residues: 3.55 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 169 aa
>ZP_03312748.1  gi|212704620|ref|ZP_03312748.1| hypothetical protein DESPIG_02683 [Desulfovibrio piger ATCC 29098]
MFKRFFLVLLAGTLLGGMPVMAATLENETAGAIVREPVLTGEQAQAMVEVVMHEARESGH
AVTVTVVDRSGQILAVLRDHHAGVHTLNASYKKAYTAASQKRETVAIARGIRDGSIPSDI
RYLDPNFSLMEGGIPIILENVVVGGIGVGGAHGSEDGRLARIGLLVLQH

CDS  cDNA 510 bp
   1 atgttcaaac gtttttttct tgtattgctg gcaggtacgc tgcttggagg gatgccggtc    60
  61 atggctgcga cactggaaaa cgagaccgcg ggcgccatcg tgcgtgagcc tgtcctgacg   120
 121 ggcgaacagg cccaggccat ggtcgaagtg gtcatgcatg aggcccggga gagcgggcat   180
 181 gccgtcaccg tgaccgtggt ggaccgctcc ggccagatac tggcggtgct gcgcgaccat   240
 241 cacgccgggg tgcatacgct caacgccagt tataaaaaag cctacacggc ggcctcccag   300
 301 aagcgcgaga cggtggccat agcccgtggc atacgggacg gctccatccc ctcggacatc   360
 361 cgctatctcg atcccaattt ttccctgatg gaaggcggca tccccatcat cctggaaaat   420
 421 gtggtggtag gcggtatcgg tgtcggcggt gcccacggca gcgaagacgg ccgtctggcc   480
 481 cgcatcggct tgctggtatt gcagcattag   510
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu