LOADING...
   ZP_03310876.1;SP18601A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_03310876.1    SP18601A            JCSG 420591 PDB Deposition 13-JUN-27              PDB id: 4lg3

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_03310876.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMDesulfovibrio piger atcc 29098
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4LG3; Identical; 21-AUG-13; UNCHARACTERIZED PROTEIN;
DR FFAS; 410638; Fold and function assignment.
DR TVPC; ZP_03310876.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_03310876.1; Ortholog view popup.
DR TPM; ZP_03310876.1; Target PDB monitor.
DR FSS; ZP_03310876.1; Target function coverage.
PROPERTY Residues: 211 aa
Molecule Weight: 23451.71 Dalton
Isoelectric Point: 9.59
Extinction Coefficient: 30940
Gravy Index: -.25
Number of Met residues: 3
Percentage of Met residues: 1.42 %
Number of Cys residues: 2
Percentage of Cys residues: 0.95 %
SEQUENCE  amino acids 211 aa
>ZP_03310876.1  gi|212702748|ref|ZP_03310876.1| hypothetical protein DESPIG_00776 [Desulfovibrio piger ATCC 29098]
MVTTRLSRILLAGLVCLFVLPLFSFSVRADEQSEAQFFAPTKESPYEGIPGRLRYNVRIV
LVEQDKQGNYIARRDSSTVSKRQLAATVIAAARYYAQEKRAAVVSITLDSQPGPAFGKTV
LATATYAPDGKGVSGSDDWTWNTLQATPRGLTAQELKIQCLWGEMRGKFQVDGSTDERRL
KAAIAKKLKIPAEKVMLNPVFPEPFPQEWTR

CDS  cDNA 636 bp
   1 atggtcacta cccgtctttc ccggattcta cttgctggtc ttgtctgtct gtttgttctc    60
  61 cccttgttct cgttctcagt ccgggcggat gaacagagcg aagcccaatt ttttgcgccc   120
 121 accaaagaaa gcccgtatga aggcatcccc ggacggctgc gctataatgt ccgtattgtt   180
 181 ctggtggagc aggacaaaca ggggaactac atagccagac gggattcttc caccgtcagc   240
 241 aagcgccagc tggcagccac tgtcatcgct gccgcccgct attatgccca agagaaacgt   300
 301 gccgctgtgg taagcatcac actggacagc cagcccggac cggccttcgg caagaccgtc   360
 361 ctcgctacag ccacctatgc ccctgacggc aagggcgtat ccggctcaga tgactggaca   420
 421 tggaacacgc tgcaagccac gccgcgcggt ctgactgccc aggaactcaa gatccaatgc   480
 481 ctttggggcg aaatgcgcgg taagttccaa gtggacggct ccacggatga aagacggctc   540
 541 aaggccgcca tcgccaaaaa attgaagatc ccggcggaaa aagtgatgct caacccggtc   600
 601 ttcccggagc ctttcccgca ggagtggacg cggtag   636
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu