LOADING...
   ZP_03310379.1;SP18498A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_03310379.1    SP18498A            JCSG 420525 PDB Deposition 15-APR-01              PDB id: 4z48

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_03310379.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMDesulfovibrio piger atcc 29098
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 3BK5; Highly similar; 05-FEB-08; PUTATIVE OUTER MEMBRANE LIPOPROTEIN-SORTING PROTE CHAIN: A;
DR FFAS; 410554; Fold and function assignment.
DR TVPC; ZP_03310379.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_03310379.1; Ortholog view popup.
DR TPM; ZP_03310379.1; Target PDB monitor.
DR FSS; ZP_03310379.1; Target function coverage.
PROPERTY Residues: 269 aa
Molecule Weight: 31127.4 Dalton
Isoelectric Point: 5.56
Extinction Coefficient: 49850
Gravy Index: -.54
Number of Met residues: 6
Percentage of Met residues: 2.23 %
Number of Cys residues: 2
Percentage of Cys residues: 0.74 %
SEQUENCE  amino acids 269 aa
>ZP_03310379.1  gi|212702251|ref|ZP_03310379.1| hypothetical protein DESPIG_00262 [Desulfovibrio piger ATCC 29098]
MTIASHRLFALFFCTLLLAGSAQAAPAITDPVKAGYDLAVRMDQVDTSQDSYSEAVMSIN
RGGKVLTRSFKTYSKHFGKDGKDEYSLIVFDRPADVNGTKYLVWSYRGLEQDDDMWVYLP
AESLVRRISGSSKFASFMRSDLSNEDIQNLDDVDEYDYLLQGEENVDGIDCYILERTPKK
GKETQYSRQVQWVRKDTLLRLRADYYDKKDRLVKKLFFSRQEKIDGIWTVTQMRVERPRE
GSFTVIDWSNLRYDVGLSDAYFEHSALQR

CDS  cDNA 810 bp
   1 atgaccatcg catcgcacag actctttgcc cttttcttct gcacgctgct ccttgccggc    60
  61 agcgcccagg ccgctcccgc gatcacagac cccgtcaagg cgggctacga tctggccgtc   120
 121 cggatggacc aggtcgacac gagccaggac tcctacagcg aagccgtcat gagcatcaac   180
 181 cgcggcggca aggtgctgac gcgctctttc aagacctatt ccaagcattt cggcaaggac   240
 241 ggcaaagacg aatacagtct gatcgtgttc gacaggcccg ccgacgtcaa cggcaccaaa   300
 301 tatctcgtct ggagttaccg cggcctggag caggatgacg acatgtgggt ctacctgccg   360
 361 gccgagagcc ttgtccgccg catcagcggt tccagcaagt tcgcctcatt catgcgcagt   420
 421 gacctctcca atgaagacat ccagaacctc gacgacgtgg acgagtacga ctacctgctg   480
 481 caaggcgagg agaacgtgga cggcatcgac tgctatatcc tggagcgcac ccccaaaaag   540
 541 gggaaagaga cccagtattc ccgccaggtg cagtgggtgc gcaaggatac cctgctgcgt   600
 601 ttgcgggcgg actactatga caagaaagac cgtctggtga aaaaactctt cttctcccgc   660
 661 caggaaaaga tcgacgggat ctggaccgtg acgcagatgc gcgtcgaacg ccccagggaa   720
 721 ggctccttca ccgtcatcga ctggtccaac ctgcgctatg acgtcggcct gagcgacgcc   780
 781 tatttcgagc acagcgccct gcagcgctag   810
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu