LOADING...
   ZP_03292136.1;BAIE
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_03292136.1    BA11652C            JCSG 421786 PDB Deposition 13-JUN-17              PDB id: 4l8o, 4leh, 4n3v, 4l8p

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_03292136.1
DESCRIPTIONHypothetical dehydratase
ORGANISMClostridium hiranonis dsm 13275
COMMENTFAAS, against Pfam, top hit Scytalone dehydratase (PF02982.7, SCYD_MAGGR/10-169, Score -51.100)
Dali top hit PUTATIVE SCYALONE DEHYDRATASE (3ef8-B, Z-score 11.4, rmsd 2.2), FATCAT is consistent with this result.
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4L8O; Identical; 21-AUG-13; BILE ACID 7A-DEHYDRATASE, BAIE;
DR PDB; 4LEH; Highly similar; 21-AUG-13; BILE ACID 7-ALPHA DEHYDRATASE, BAIE;
DR PDB; 4L8P; Highly similar; 21-AUG-13; BILE ACID 7A-DEHYDRATASE, BAIE;
DR PDB; 4N3V; Highly similar; 04-DEC-13; BILE ACID 7-ALPHA DEHYDRATASE, BAIE;
DR KEGG; 4.; Enzyme page
DR FFAS; 421786; Fold and function assignment.
DR TVPC; ZP_03292136.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_03292136.1; Ortholog view popup.
DR TPM; ZP_03292136.1; Target PDB monitor.
DR FSS; ZP_03292136.1; Target function coverage.
PROPERTY Residues: 168 aa
Molecule Weight: 19616.24 Dalton
Isoelectric Point: 5.3
Extinction Coefficient: 29910
Gravy Index: -.67
Number of Met residues: 6
Percentage of Met residues: 3.57 %
Number of Cys residues: 1
Percentage of Cys residues: 0.60 %
SEQUENCE  amino acids 168 aa
>ZP_03292136.1  gi|210620588|ref|ZP_03292136.1| hypothetical protein CLOHIR_00079 [Clostridium hiranonis DSM 13275]
MTLEARIEALEKEIQRLNDIEAIKQLKAKYFRCLDGKLWDELETTLSPNIETSYSDGKLV
FHSPKEVTEYLAAAMPKEEISMHMGHTPEITIDSENTATGRWYLEDNLIFTDGKYKNVGI
NGGAFYTDKYEKIDGQWYIKETGYVRIFEEHFMRDPKIHITSNMHKEK

CDS  cDNA 510 bp
   1 atgagtattg aagaaagatt agaagcattg gaaaaagaga tccagaagat gaaagatatt    60
  61 gaagagataa aaaaattgaa aggccagtat ttccggtgcc ttgacggcaa gttctgggat   120
 121 gaactggaga ctacactctc cccgaacatt gtaacttcct actccaacgg caagcttgtg   180
 181 ttccacggtc caaaggaagt cacagactat tttaagaagg cgatgccgag ggaagaaata   240
 241 agcatgcaca tgggacacac tccggagatc acgatcgaca gtgagactac ggcgacaggc   300
 301 agatggtatc tggaggataa actgatcttt acagaagaaa gcaagtatgc cggttcaggc   360
 361 gtgaacggcg gcgcatttta cacagataag tatgagaagg tggacggcaa atggtatatt   420
 421 cttgagaccg ggtatcttcg tgtttacgag gaacatttta tgcgcgaccc gaagatcaag   480
 481 atcacgatga acatgcacaa aacaaaataa   510
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu