LOADING...
   ZP_02996603.1;SP18282A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02996603.1    SP18282A            JCSG 420905 PDB Deposition 14-JUL-01              PDB id: 4qrk

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02996603.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMClostridium sporogenes atcc 15579
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4QRK; Identical; 23-JUL-14; HYPOTHETICAL PROTEIN;
DR FFAS; 410465; Fold and function assignment.
DR TVPC; ZP_02996603.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02996603.1; Ortholog view popup.
DR TPM; ZP_02996603.1; Target PDB monitor.
DR FSS; ZP_02996603.1; Target function coverage.
PROPERTY Residues: 247 aa
Molecule Weight: 27035.66 Dalton
Isoelectric Point: 8.96
Extinction Coefficient: 19940
Gravy Index: -.46
Number of Met residues: 3
Percentage of Met residues: 1.21 %
Number of Cys residues: 1
Percentage of Cys residues: 0.40 %
SEQUENCE  amino acids 247 aa
>ZP_02996603.1  gi|187780130|ref|ZP_02996603.1| hypothetical protein CLOSPO_03726 [Clostridium sporogenes ATCC 15579
MNIKKLFSIFTLVILVFATACTNKSEKATVSDTNEKPKEEIKIVEPNGAEKTKLNLNFGV
GKLNISGNEEKLMKGKFIYSENEWKPEIKYEVKDKDGELEISQPGLKSGNVSLNNKRNEW
NINLNEKIPTEIKLSLGTGEFKADLSKINLKELNVGMGVGKVDLDISGNYKNNVKVNIEG
GVGEATVYLPKSIGVKIKAEKGVGAVNANGFIVEGENIYKNSQYGKSKNSIEVNIEAGVG
AINIKQK

CDS  cDNA 744 bp
   1 atgaatatta aaaagctttt ttcaatattt acattagtaa ttctagtttt tgctacagca    60
  61 tgtacaaata aaagtgaaaa agccactgta agtgatacaa atgaaaaacc aaaggaagaa   120
 121 ataaaaattg tagaacctaa tggagcagaa aaaacaaaac ttaatttaaa ttttggagta   180
 181 ggaaaattaa atataagtgg taatgaagaa aagcttatga agggtaaatt tatatacagt   240
 241 gaaaatgagt ggaaaccgga aataaagtat gaagttaaag ataaagacgg agaacttgaa   300
 301 atttctcagc ctggattaaa aagtggaaat gtatctttaa ataataaacg taatgaatgg   360
 361 aatataaact taaatgagaa aatacctaca gagataaaat taagtctagg gacaggagaa   420
 421 tttaaggcag atttgagtaa gataaattta aaagaattaa atgtggggat gggagtagga   480
 481 aaagtagatt tggatatatc aggaaattat aaaaacaatg ttaaagtaaa tatagaagga   540
 541 ggcgttggag aagccactgt atatttacct aaatccatag gagttaagat aaaagccgaa   600
 601 aaaggagtag gagcagttaa cgctaatgga tttatagtag aaggcgaaaa tatctataaa   660
 661 aattctcaat atggaaaaag taaaaatagc atagaggtta atattgaagc tggagtggga   720
 721 gctattaata taaaacaaaa gtaa   744
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu