LOADING...
   ZP_02994499.1;SP18434A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02994499.1    SP18434A            JCSG 420071 PDB Deposition 14-APR-02              PDB id: 4q0y

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02994499.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMClostridium sporogenes atcc 15579
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4Q0Y; Identical; 18-JUN-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 410518; Fold and function assignment.
DR TVPC; ZP_02994499.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02994499.1; Ortholog view popup.
DR TPM; ZP_02994499.1; Target PDB monitor.
DR FSS; ZP_02994499.1; Target function coverage.
PROPERTY Residues: 163 aa
Molecule Weight: 18949.86 Dalton
Isoelectric Point: 8.55
Extinction Coefficient: 14900
Gravy Index: -.18
Number of Met residues: 3
Percentage of Met residues: 1.84 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 163 aa
>ZP_02994499.1  gi|187778026|ref|ZP_02994499.1| hypothetical protein CLOSPO_01618 [Clostridium sporogenes ATCC 15579
MKKTNKIIFIVFIVIFIGLSYRHFTNTDKARMEISSLSSIDVFKFNSFSKFSNDKIGVIY
DEEKLSKFKVIMNSLDTSEGIKKIEVPKDANIESFKYSYHIQPNLKYVEDNNVYDGYFLL
YILVGDSEGKSYIIFSGTELSYVLDKNNTNILKEIFLNVKKQQ

CDS  cDNA 492 bp
   1 atgaaaaaga ctaataaaat tatttttatt gtattcattg ttatatttat aggcttgtca    60
  61 tatagacatt ttactaacac agataaagct agaatggaaa tttcatcatt atcaagcata   120
 121 gatgttttta agtttaatag cttttctaaa tttagtaatg ataagatagg tgtaatttat   180
 181 gatgaagaaa aattatcaaa gtttaaagtg attatgaatt cactagatac atcagaggga   240
 241 attaaaaaaa tagaagttcc taaagatgct aatatagaat catttaaata ttcttatcat   300
 301 atacaaccta acctaaaata tgttgaagac aataatgtgt atgatggtta ctttcttttg   360
 361 tacattttgg taggtgattc agaagggaaa tcatacataa ttttttctgg aacagaattg   420
 421 agttatgttc ttgataaaaa caatacaaat attttaaaag aaatattttt aaatgtaaaa   480
 481 aaacaacaat aa   492
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu