LOADING...
   ZP_02430688;ZP_02430688
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02430688    B.SL21247A            JCSG 429181 PDB Deposition 14-JAN-16              PDB id: 4oh1

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02430688
DESCRIPTIONCASP Target
Description Hidden
ORGANISMClostridium scindens atcc 35704
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00107; ADH_zinc_N;
DR Pfam; PF08240; ADH_N;
DR PDB; 4OH1; Identical; 05-FEB-14; L-IDITOL 2-DEHYDROGENASE;
DR PDB; 4EJ6; Highly similar; 02-MAY-12; PUTATIVE ZINC-BINDING DEHYDROGENASE;
DR PDB; 4EJM; Highly similar; 02-MAY-12; PUTATIVE ZINC-BINDING DEHYDROGENASE;
DR PDB; 2D8A; Highly similar; 02-JUN-06; PROBABLE L-THREONINE 3-DEHYDROGENASE;
DR PDB; 2DFV; Highly similar; 16-JAN-07; PROBABLE L-THREONINE 3-DEHYDROGENASE;
DR PDB; 2DQ4; Highly similar; 12-JUN-07; L-THREONINE 3-DEHYDROGENASE;
DR PDB; 2EJV; Highly similar; 25-MAR-08; L-THREONINE 3-DEHYDROGENASE;
DR PDB; 4ILK; Highly similar; 30-JAN-13; STARVATION SENSING PROTEIN RSPB;
DR FFAS; 429181; Fold and function assignment.
DR TVPC; ZP_02430688; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02430688; Ortholog view popup.
DR TPM; ZP_02430688; Target PDB monitor.
DR FSS; ZP_02430688; Target function coverage.
PROPERTY Residues: 350 aa
Molecule Weight: 38579.44 Dalton
Isoelectric Point: 5.33
Extinction Coefficient: 34840
Gravy Index: -.11
Number of Met residues: 20
Percentage of Met residues: 5.71 %
Number of Cys residues: 7
Percentage of Cys residues: 2.00 %
SEQUENCE  amino acids 350 aa
>ZP_02430688  ZP_02430688 
MRQLFVTSIRDFEKNTMGTVDMMEAPMPEPKDEEIRIKVVYASICGSDTHILTGNLGEME
STTRSMLPMSFGHELSGVIDKVGSTAEKMGFKVGQKVVANYAKYCGCCENCREGKVNLCS
NMGYRMNGFSEYAVYHMSQIFPIPDDADLKDYALVEPLTVALSSAEQAKISYGKSVAIMG
AGGLGMMLVQLARLAGASTITVFDIVPEKLELALENGADYALNSAEEGVAERAIELAGGR
YDCVLEGTGATAAAKLGLQLLARDGDAVYFAMYGKDPILPVNLQSDLYWDQKHIHGMIQG
AWQFPKSIRMIPRMDFSKIIQKEHTLTNYKQAFEDLYSKKYAKIVIKMDE

CDS  cDNA 1050 bp
   1 atgagacaat tatttgttac ttccattcgt gatttcgaga aaaacacgat gggtactgtt    60
  61 gatatgatgg aagctcctat gccggaaccg aaggatgaag aaatccgtat caaggtagtt   120
 121 tatgcgtcca tttgtggttc cgatacacat attcttaccg gaaatctggg tgaaatggaa   180
 181 tcaactaccc gttccatgct tcctatgagc ttcggacacg agctttccgg tgtgatcgat   240
 241 aaagtaggtt ctacagcaga aaagatggga ttcaaggttg gacagaaggt tgttgcaaac   300
 301 tatgcaaaat actgtggatg ctgcgaaaac tgccgcgaag gaaaagtaaa cctctgctcc   360
 361 aatatgggat atcggatgaa tggattttcc gagtatgcag tttatcacat gagtcagatt   420
 421 ttcccgattc ccgatgatgc agatctgaaa gattatgcac tggtagagcc ccttaccgta   480
 481 gctctttctt ccgcagagca ggccaaaatc tcctacggaa aatcggtagc aatcatgggt   540
 541 gcaggtggtc ttggaatgat gctggtacag ctggctcgtc ttgcaggagc aagcaccatt   600
 601 acagtattcg atattgttcc ggaaaaactg gagctggcac ttgaaaacgg tgcagattat   660
 661 gcactgaatt cagcagaaga aggggtcgct gaaagagcta tcgaactggc aggcggacgt   720
 721 tatgactgtg ttctggaagg aaccggagca actgctgcag caaaactggg acttcagctt   780
 781 ctggctcgtg acggagatgc agtttacttc gcaatgtacg gaaaggatcc catccttccg   840
 841 gtaaatcttc agagtgatct gtactgggat cagaaacata ttcacggaat gattcagggt   900
 901 gcatggcagt ttccgaaatc catccgcatg attcctcgta tggacttttc caagattatt   960
 961 cagaaagaac atacactgac caattataaa caggcttttg aagatcttta ttcaaagaaa  1020
1021 tatgcaaaga tcgtaattaa gatggacgaa  1050
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu