LOADING...
   ZP_02422547.1;SP17906A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02422547.1    SP17906A            JCSG 420689 PDB Deposition 14-AUG-06              PDB id: 4r1k

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02422547.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMEubacterium siraeum dsm 15702
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4R1K; Identical; 01-OCT-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 411277; Fold and function assignment.
DR TVPC; ZP_02422547.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02422547.1; Ortholog view popup.
DR TPM; ZP_02422547.1; Target PDB monitor.
DR FSS; ZP_02422547.1; Target function coverage.
PROPERTY Residues: 166 aa
Molecule Weight: 19343.72 Dalton
Isoelectric Point: 4.61
Extinction Coefficient: 30370
Gravy Index: -.5
Number of Met residues: 7
Percentage of Met residues: 4.22 %
Number of Cys residues: 5
Percentage of Cys residues: 3.01 %
SEQUENCE  amino acids 166 aa
>ZP_02422547.1  gi|167750420|ref|ZP_02422547.1| hypothetical protein EUBSIR_01394 [Eubacterium siraeum DSM 15702]
MDSLVKIMGSFLALSLIMIFSSCIVNEHVDEGNIKENAVRMMECIVNKDSEKLFDFYNKD
MKDNYKDSSLDEIRQLFEYIDGAITSYNYEGKGGGQEAKNDGIICYYSCHPEFDFTTETG
QEYTISFSYHYIWNEHPEYEGINMIQICKDGNWGEKLIIGRNYYKE

CDS  cDNA 501 bp
   1 atggatagct tggtaaaaat aatgggttct tttttggcat taagccttat tatgattttc    60
  61 tcatcttgta ttgtaaatga acatgttgat gaaggcaaca ttaaagaaaa tgcagtccga   120
 121 atgatggaat gtattgtcaa taaagattct gaaaaattgt tcgattttta taacaaagat   180
 181 atgaaggata attataaaga tagctctttg gacgaaataa gacagctttt tgaatatatc   240
 241 gatggtgcga ttacttcata taactatgaa ggtaaaggag gaggtcaaga agctaaaaac   300
 301 gacggtataa tttgctatta cagttgccat cctgaatttg atttcaccac cgaaaccggg   360
 361 caagaatata cgatttcgtt ttcatatcat tatatatgga atgaacatcc tgagtatgag   420
 421 ggaatcaata tgatccaaat atgcaaagac ggaaattggg gcgaaaaact tataattggc   480
 481 agaaattatt acaaagaata a   501
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu