LOADING...
   ZP_02422542.1;SP17770A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02422542.1    SP17770A            JCSG 420658 PDB Deposition 14-JAN-07              PDB id: 4obm

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02422542.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMEubacterium siraeum dsm 15702
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4OBM; Identical; 12-FEB-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 411231; Fold and function assignment.
DR TVPC; ZP_02422542.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02422542.1; Ortholog view popup.
DR TPM; ZP_02422542.1; Target PDB monitor.
DR FSS; ZP_02422542.1; Target function coverage.
PROPERTY Residues: 281 aa
Molecule Weight: 31312.7 Dalton
Isoelectric Point: 4.69
Extinction Coefficient: 30830
Gravy Index: -.21
Number of Met residues: 6
Percentage of Met residues: 2.14 %
Number of Cys residues: 2
Percentage of Cys residues: 0.71 %
SEQUENCE  amino acids 281 aa
>ZP_02422542.1  gi|167750415|ref|ZP_02422542.1| hypothetical protein EUBSIR_01389 [Eubacterium siraeum DSM 15702]
MVTGLLLILVSSILLKSFYDSQDKDATVNVSQNQTAIFTPDSTYDFSVLMTLSADNDKTP
DKYMTITYIAKNNTFVLMPYLPNAVIDGGNTIKQICEQSGEAEVAKLLSSKTGLSINKYI
RFTKSTLTELFDMVGNTTLTVPSEIKYENKKDNTVTIIKKGTQIFTAEQMYAYLTLPDYG
VKDELYPCKLNATVISSFIDQNFIGTSSKTLDEYINFIINFTNTNIEQSDYDAKVKAIVY
TLSQNKSSVTDFYIPYGDKSGDDYIIDDNSWNSAKKALGTG

CDS  cDNA 846 bp
   1 gtggtaacgg gtctacttct gatattggtt tcatccatat tgctaaaatc attctatgac    60
  61 tcgcaggata aggacgcaac agtaaacgtt tcgcagaatc agacggctat tttcactccg   120
 121 gattcaacct acgatttttc tgttctcatg acgctttccg ccgataatga caagacgccc   180
 181 gataaataca tgacaatcac atacatagcc aagaacaaca catttgttct tatgccgtat   240
 241 cttccgaatg ccgtaattga cggcggaaat accataaagc agatatgtga gcagtccgga   300
 301 gaagcggagg ttgcaaaact gctctcgtca aagaccggtc ttagcataaa caaatatatc   360
 361 cgctttacaa aatccacgct tacagagctg ttcgatatgg taggaaacac aacgctgacc   420
 421 gtaccgagcg agataaagta cgagaataaa aaggataaca ccgtgactat tataaagaag   480
 481 ggtacgcaga ttttcactgc cgagcagatg tacgcttacc tcacactgcc cgattacgga   540
 541 gtcaaggacg agctttatcc ctgcaagctg aacgcaacgg tcatttcatc gtttatcgat   600
 601 cagaatttca tcggcacaag cagtaaaacg ctggacgaat atattaactt tattatcaat   660
 661 ttcaccaaca cgaatatcga gcagagcgat tatgacgcaa aggtcaaggc aatcgtctat   720
 721 acgctgtcgc agaacaagtc gagcgtgacc gatttctata ttccttacgg tgacaagagc   780
 781 ggcgatgact atatcattga cgataacagc tggaacagtg ctaaaaaggc tttgggaaca   840
 841 ggctaa   846
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu