LOADING...
   ZP_02421584.1;SP17732C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02421584.1    SP17732C            JCSG 420664 PDB Deposition 13-DEC-12              PDB id: 4nzk

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02421584.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMEubacterium siraeum dsm 15702
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4NZK; Identical; 15-JAN-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 411242; Fold and function assignment.
DR TVPC; ZP_02421584.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02421584.1; Ortholog view popup.
DR TPM; ZP_02421584.1; Target PDB monitor.
DR FSS; ZP_02421584.1; Target function coverage.
PROPERTY Residues: 384 aa
Molecule Weight: 42219.12 Dalton
Isoelectric Point: 4.57
Extinction Coefficient: 48250
Gravy Index: -.39
Number of Met residues: 6
Percentage of Met residues: 1.56 %
Number of Cys residues: 6
Percentage of Cys residues: 1.56 %
SEQUENCE  amino acids 384 aa
>ZP_02421584.1  gi|167749457|ref|ZP_02421584.1| hypothetical protein EUBSIR_00411 [Eubacterium siraeum DSM 15702]
MKLNIRLTAAILACASILTSASACSSQNTSSATDSKNESSLTESSATESKDNTKSDTTSD
NSSASSESTVSSDESSSENKKPVGVDGVQTNGQLVVDIDGHTWGISLYGGGDGANYASYL
NEFKEKVGSSVNVFNMVVPTAGAYYLPEGYEKYNASHRDSINSIANKLVNVINVDGYAAL
EAHTNEYIYTRTDHHWEPLGAYYAAKAFCEMAQVPVKELSTYKTETIEGFVGTMYAFTEY
NERIKNDPDTFTYYIPSTDYTATYYTTDFKADEQFTQFHSIFVDQPASGAYSTFMGGDQK
IVKIETANKNGRKLCIFKDSYGNAEVPFFIDSFEEIYVCDIRYFDLYAPDFIKDNGITDV
LFTMCTFSAVGENAEGIKNNLLSK

CDS  cDNA 1155 bp
   1 atgaagttaa atatcaggtt aacagcggca atacttgcct gtgcgtcaat tctgacgtcg    60
  61 gcctccgcct gctcatcaca gaatacaagc tccgccacgg acagcaaaaa cgaaagcagt   120
 121 ttaacggaaa gctccgctac agaaagcaag gataatacaa aaagcgatac aacaagcgat   180
 181 aattcatccg catcttcaga aagcaccgtt tcttccgatg aatcatcgtc cgaaaacaag   240
 241 aagcctgtcg gcgttgacgg cgttcagaca aacggccagc ttgtcgttga catagacggt   300
 301 catacatggg gcatctccct ttacggcggc ggcgacggtg caaactatgc gtcatacctt   360
 361 aacgagttca aggaaaaggt aggctcatcg gtaaacgtat tcaatatggt agtgcctaca   420
 421 gcaggcgcat actacctccc cgaaggctac gaaaaataca acgcaagcca cagagattcg   480
 481 ataaacagca ttgcaaacaa gctggtgaac gtgataaacg ttgacggata cgccgcactt   540
 541 gaggcgcaca caaacgagta catctatacc cgtaccgatc accactggga acccctcggc   600
 601 gcatattatg cggcaaaggc tttctgtgaa atggcacagg tacccgtaaa ggagctttcg   660
 661 acctacaaga cggaaacgat agagggtttt gtcggaacaa tgtacgcatt taccgagtat   720
 721 aacgagcgca tcaagaatga ccccgatacc ttcacctact atatcccctc tacagattac   780
 781 accgcaacct attataccac cgacttcaag gctgatgagc agttcacaca gttccacagc   840
 841 atatttgtag atcagcctgc aagcggtgca tattcgacct ttatgggcgg tgatcagaag   900
 901 atagtaaaga tagaaaccgc aaacaagaac ggcagaaagc tctgcatctt caaggacagc   960
 961 tacggcaatg ccgaagttcc cttctttata gattcctttg aggaaatcta cgtttgcgac  1020
1021 atccgctact ttgaccttta cgcacccgac tttattaagg ataacggcat taccgacgtt  1080
1081 ctgttcacaa tgtgtacatt ctccgctgtc ggtgaaaatg cagagggtat aaagaacaac  1140
1141 ctgctttcaa agtaa  1155
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu