LOADING...
   ZP_02080996.1;SP17865A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02080996.1    SP17865A            JCSG 418393 PDB Deposition 14-MAR-18              PDB id: 4pw1

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02080996.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMClostridium leptum
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4PW1; Identical; 18-JUN-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 410159; Fold and function assignment.
DR TVPC; ZP_02080996.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02080996.1; Ortholog view popup.
DR TPM; ZP_02080996.1; Target PDB monitor.
DR FSS; ZP_02080996.1; Target function coverage.
PROPERTY Residues: 285 aa
Molecule Weight: 32931.42 Dalton
Isoelectric Point: 4.32
Extinction Coefficient: 51800
Gravy Index: -.33
Number of Met residues: 11
Percentage of Met residues: 3.86 %
Number of Cys residues: 3
Percentage of Cys residues: 1.05 %
SEQUENCE  amino acids 285 aa
>ZP_02080996.1  gi|160933608|ref|ZP_02080996.1| hypothetical protein CLOLEP_02462 [Clostridium leptum DSM 753]
MMKLARKSVPFIIAVALLAACLLAVGLSPLVLPDYKGTIEEREQPQNFNLLYLNSGEELN
LYPWNLYTGQEQELFEEEIVSFAANSVRILGGGSWTDEELYPLIKFRYSGQDLRFLKDMA
LTEKDGRRYLVNMALDPNGLCYFSYVNQDEREATADEMDQALGKLQEDWEKFLSDPLPAD
SEVDLYEEKPSGSYQLDDGELKTDNAFYMFFMRCQMLSDQMRKEQYSDYIGDNLYTIWEL
VLKSEFTSLSYDNHIYAMYSNDGGTSMVLIYSPIEERFVGFSLKY

CDS  cDNA 858 bp
   1 atgatgaaat tagcgagaaa aagcgtgccg tttatcattg cggtagcttt gctggcggcg    60
  61 tgcctgctgg cggttggatt atcgcctttg gttcttccgg actataaggg aaccatcgag   120
 121 gaaagagagc agccccaaaa tttcaacctc ctttatctta acagcggaga ggagctgaat   180
 181 ctctaccctt ggaacctgta tacgggccag gagcaggagc ttttcgagga ggagatagtc   240
 241 agctttgcgg caaacagcgt gcggattttg ggcggcggct cttggaccga tgaagagctt   300
 301 tatcctttga ttaaatttcg gtattcgggc caggatttga ggtttttaaa ggatatggcg   360
 361 ctcaccgaaa aggacggcag gcggtattta gtaaatatgg ctctcgatcc taacggcctt   420
 421 tgctattttt cctatgtgaa tcaggatgag cgggaggcaa cggctgatga aatggaccag   480
 481 gccctcggca agctccaaga ggattgggag aagtttctgt cagatccgct gccggcagac   540
 541 agtgaagtgg atctgtatga agaaaagcct tcgggaagct atcagctgga cgatggggag   600
 601 ttgaaaacgg ataacgcgtt ttatatgttt tttatgcgct gccagatgct gagtgatcag   660
 661 atgagaaaag agcagtattc cgattatata ggggataatt tatacacgat ctgggaactg   720
 721 gttctgaaat cagagtttac cagcttgtcg tatgataacc acatttacgc catgtattcc   780
 781 aatgatggcg gaacatccat ggttttgatt tacagcccga tagaggaacg ctttgtaggc   840
 841 ttcagcttaa aatactga   858
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu