LOADING...
   ZP_02073262.1;SP13737C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02073262.1    SP13737C            JCSG 417927 PDB Deposition 13-SEP-26              PDB id: 4mxt

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02073262.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides uniformis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4MXT; Identical; 16-OCT-13; UNCHARACTERIZED PROTEIN;
DR FFAS; 409399; Fold and function assignment.
DR TVPC; ZP_02073262.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02073262.1; Ortholog view popup.
DR TPM; ZP_02073262.1; Target PDB monitor.
DR FSS; ZP_02073262.1; Target function coverage.
PROPERTY Residues: 216 aa
Molecule Weight: 24646.98 Dalton
Isoelectric Point: 6.17
Extinction Coefficient: 38850
Gravy Index: -.29
Number of Met residues: 8
Percentage of Met residues: 3.70 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 216 aa
>ZP_02073262.1  gi|160892259|ref|ZP_02073262.1| hypothetical protein BACUNI_04723 [Bacteroides uniformis ATCC 8492]
MVIYRMMKFDKLLLGVLLLLFAVPMSAQQPDAKNILERTAEAFRKAGGVKLAFTVNEQQG
SYAGVLYLEGEKFVVETEGMKTWFDGHTQWSYVASADEVNVSEPTQEELQTLNPYAWLSL
YKQGYRLKLSSVGGKQDKSVYYITMTAADKRKDPESVYLFVTKDTYRLHQVDLAPRGSKY
MTTILIDSYQTGQSYPDSFFVFDKKAYPTAEVIDMR

CDS  cDNA 651 bp
   1 atggttattt atagaatgat gaaatttgat aagcttttac ttggtgtgct attgctgttg    60
  61 tttgctgtgc cgatgtcggc acaacaaccg gatgccaaga atatattgga gcgtacagcc   120
 121 gaagcctttc ggaaagcggg aggggtgaag ctggcgttta ccgtgaacga acaacaaggc   180
 181 tcttatgcgg gagttctcta tctggaaggt gagaagtttg tggttgagac cgagggaatg   240
 241 aagacttggt ttgacggaca tacgcagtgg agctatgtgg cttcggcaga tgaggtgaat   300
 301 gtatcggaac ctacgcagga ggaattgcag actcttaatc cgtatgcttg gttgtccctc   360
 361 tacaagcagg gatacagatt gaagttgagc agtgtcggtg gtaagcaaga caagtctgtt   420
 421 tattacatca ccatgactgc tgccgacaag agaaaagacc ctgaaagtgt ctatctgttt   480
 481 gtgacaaagg atacgtatcg tctgcatcaa gtggacttgg caccacgggg gagtaagtat   540
 541 atgactacta tccttattga tagctaccag acaggacaat cctatccgga tagtttcttt   600
 601 gtctttgaca aaaaagccta tcccacagct gaagtcatcg acatgcgcta a   651
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu