LOADING...
   ZP_02073211.1;SP13263A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02073211.1    SP13263A            JCSG 417801 PDB Deposition 14-JUL-01              PDB id: 4qrj

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02073211.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides uniformis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF10282; Lactonase;
DR PDB; 4QRJ; Identical; 23-JUL-14; PUTATIVE 6-PHOSPHOGLUCONOLACTONASE;
DR PDB; 3SCY; Highly similar; 20-JUL-11; HYPOTHETICAL BACTERIAL 6-PHOSPHOGLUCONOLACTONASE;
DR PDB; 3FGB; Highly similar; 23-DEC-08; UNCHARACTERIZED PROTEIN Q89ZH8_BACTN;
DR PDB; 3HFQ; Highly similar; 26-MAY-09; UNCHARACTERIZED PROTEIN LP_2219;
DR PDB; 1RI6; Highly similar; 25-NOV-03; PUTATIVE ISOMERASE YBHE;
DR FFAS; 409178; Fold and function assignment.
DR TVPC; ZP_02073211.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02073211.1; Ortholog view popup.
DR TPM; ZP_02073211.1; Target PDB monitor.
DR FSS; ZP_02073211.1; Target function coverage.
PROPERTY Residues: 375 aa
Molecule Weight: 40199.95 Dalton
Isoelectric Point: 4.87
Extinction Coefficient: 20860
Gravy Index: -.09
Number of Met residues: 7
Percentage of Met residues: 1.87 %
Number of Cys residues: 7
Percentage of Cys residues: 1.87 %
SEQUENCE  amino acids 375 aa
>ZP_02073211.1  gi|160892208|ref|ZP_02073211.1| hypothetical protein BACUNI_04672 [Bacteroides uniformis ATCC 8492]
MKTLLFCMLGLGLTACGSSPKGTNGDQDELAMLIGTYTNGSSKGIYTFRFNQETGTAVPL
SSAALPNPSYLVPSEDGEFVYAVSEMNDSTAALSSLAFDRETGELRLLNTVPTFGADPCY
VATNGREVLTANYSGGTMSVFPLQKDGTLAPADTLFQGSATGPDAIRQATPHIHCTVFSP
DGKYIFATDFSADRILRFVMHPDNPIPHASLEAVGIEADSGPRHLTFSPNGKFAYLITEL
SGKVIAFSYDDGCLEQIQTITADTVAARGSADIHLSPDGKYLYASNRLKEDGIAIFAVNP
ENGTLAKVGYQPTGIHPRNFNITPNGKYLLAACRDSNVIQVYKRNEVTGLLEDTHQDIVV
DMPVCVQFVSSVNNL

CDS  cDNA 1128 bp
   1 atgaaaacac ttcttttctg tatgctcgga ttaggtttga cagcatgtgg ctcttctcca    60
  61 aagggcacta acggtgacca ggacgaactc gccatgctaa taggtactta cacgaatggc   120
 121 tcaagcaagg gtatctatac cttccgcttt aatcaggaga cgggaacagc cgttccgctc   180
 181 agttcagcgg cattgcccaa tccctcctac ctcgtcccct cggaagatgg cgaatttgtc   240
 241 tatgccgtca gtgaaatgaa cgacagcaca gcagccctca gctcccttgc cttcgaccgg   300
 301 gaaacgggag aactgcgcct gctgaacacc gttcccacct tcggcgccga cccctgctac   360
 361 gtggccacca atggccggga agtgttgact gccaactaca gcggtggaac catgtccgtc   420
 421 tttcctttac agaaagacgg cactttggct cctgcagaca cgctctttca aggctctgcc   480
 481 accggtcccg acgccatacg gcaagccact ccccacatcc attgcacggt cttttcaccg   540
 541 gacggaaagt atatcttcgc caccgacttc agtgccgacc gcatcctgcg ctttgtgatg   600
 601 caccccgaca accctattcc tcatgcttct ctggaagccg ttggcattga ggcagattcc   660
 661 ggcccgcgcc atctgacatt cagccctaac gggaagtttg cctatctcat caccgaactg   720
 721 tccggtaagg tcattgcctt cagttacgac gacggctgcc tggaacagat acagactatc   780
 781 acagccgaca ccgtagccgc ccgtggaagt gcagacatcc acctcagtcc ggatgggaaa   840
 841 tacctctacg ccagcaaccg tctgaaagaa gacggcatcg ccatctttgc cgtgaatccc   900
 901 gaaaatggga ccttggcaaa ggtaggttat cagcccaccg gcatccatcc ccgcaacttc   960
 961 aacatcacgc ccaacggtaa atacttgctt gccgcctgcc gcgacagcaa tgtcattcag  1020
1021 gtatacaaac gaaacgaagt taccggactc ttggaagata ctcatcagga cattgtagtc  1080
1081 gacatgccgg tttgcgtaca gttcgtcagc tctgttaata atttataa  1128
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu