LOADING...
   ZP_02073090.1;SP13115D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02073090.1    SP13115D            JCSG 417915 PDB Deposition 14-JUN-19              PDB id: 4qoa

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02073090.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides uniformis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4QOA; Identical; 16-JUL-14; PUTATIVE PERIPLASMIC PROTEIN;
DR PDB; 4POI; Highly similar; 12-MAR-14; PUTATIVE PERIPLASMIC PROTEIN;
DR PDB; 4DSD; Highly similar; 21-MAR-12; PUTATIVE PERIPLASMIC PROTEIN;
DR PDB; 3ELG; Highly similar; 14-OCT-08; UNCHARACTERIZED PERIPLASMIC PROTEIN;
DR PDB; 3DB7; Highly similar; 28-OCT-08; PUTATIVE CALCIUM-REGULATED PERIPLASMIC PROTEIN;
DR PDB; 3DUE; Highly similar; 05-AUG-08; PUTATIVE PERIPLASMIC PROTEIN;
DR FFAS; 409387; Fold and function assignment.
DR TVPC; ZP_02073090.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02073090.1; Ortholog view popup.
DR TPM; ZP_02073090.1; Target PDB monitor.
DR FSS; ZP_02073090.1; Target function coverage.
PROPERTY Residues: 146 aa
Molecule Weight: 16685.6 Dalton
Isoelectric Point: 8.89
Extinction Coefficient: 11460
Gravy Index: -.21
Number of Met residues: 2
Percentage of Met residues: 1.37 %
Number of Cys residues: 1
Percentage of Cys residues: 0.68 %
SEQUENCE  amino acids 146 aa
>ZP_02073090.1  gi|160892087|ref|ZP_02073090.1| hypothetical protein BACUNI_04550 [Bacteroides uniformis ATCC 8492]
MKKVLSILVLALVAVQFAFAGDVITQDTKQLPLTARNFINQYFSKPHISHIKIESEILQT
KKYEVLLTDRTEIDFDKKGNWLEVDCKKSAVPEALIPVPVKEYVKANFPREIITKIERGR
TGVEIELGNDYSLKFNKKGKFVSMDD

CDS  cDNA 441 bp
   1 atgaagaaag tattgtctat tcttgtgttg gctcttgtag ctgttcagtt tgcctttgcc    60
  61 ggtgatgtca tcactcagga taccaagcag cttccgctga cggcacgcaa ttttatcaac   120
 121 cagtatttct cgaaaccgca catttcacac atcaagattg aaagtgaaat attgcagact   180
 181 aaaaaatatg aagtgctgtt gacagaccgt acggaaatag acttcgacaa gaaaggaaat   240
 241 tggttggaag tggattgcaa gaagtccgct gttcccgaag cattgattcc ggttccggta   300
 301 aaggagtatg tgaaggctaa cttcccgaga gagattatta ctaaaatcga acgcggacgt   360
 361 accggtgtgg aaattgaatt gggtaatgac tactctttga agttcaacaa aaagggaaag   420
 421 ttcgtcagca tggacgattg a   441
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu