LOADING...
   ZP_02072838.1;SP13297C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02072838.1    SP13297C            JCSG 417916 PDB Deposition 14-APR-15              PDB id: 4q53

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02072838.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides uniformis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4Q53; Identical; 16-JUL-14; UNCHARACTERIZED PROTEIN;
DR PDB; 4OUQ; Highly similar; 30-APR-14; UNCHARACTERIZED PROTEIN;
DR PDB; 4ORL; Highly similar; 05-MAR-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 409388; Fold and function assignment.
DR TVPC; ZP_02072838.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02072838.1; Ortholog view popup.
DR TPM; ZP_02072838.1; Target PDB monitor.
DR FSS; ZP_02072838.1; Target function coverage.
PROPERTY Residues: 130 aa
Molecule Weight: 14704.22 Dalton
Isoelectric Point: 9.63
Extinction Coefficient: 8480
Gravy Index: -.25
Number of Met residues: 3
Percentage of Met residues: 2.31 %
Number of Cys residues: 1
Percentage of Cys residues: 0.77 %
SEQUENCE  amino acids 130 aa
>ZP_02072838.1  gi|160891835|ref|ZP_02072838.1| hypothetical protein BACUNI_04292 [Bacteroides uniformis ATCC 8492]
MKKRVIFLLTGLFIWTSVLLAQNVPEGVIGAFKEGNSQELNKYLGDKVDLIIQNKSTHAD
KRTAEGTMAAFFSNHKVGSFNVNHQGKRDESGFVIGILMTANGNFRVNCFFRKVQNKYVI
HQIRIDKTDE

CDS  cDNA 393 bp
   1 atgaaaaaac gggtaatctt tttgttgacc ggtctcttca tttggacgtc tgtgctgctg    60
  61 gcccagaatg ttcccgaggg agtgattgga gccttcaagg aaggaaactc tcaggagctc   120
 121 aacaagtatc tgggtgacaa ggtcgattta atcattcaga ataagtcgac ccacgccgat   180
 181 aagcggacgg cagagggcac aatggctgct ttcttctcca accacaaggt cggcagtttt   240
 241 aatgtgaacc atcaggggaa gcgcgatgag tccggtttcg tcatcggtat cttgatgacc   300
 301 gcaaatggaa actttcgggt gaattgtttc ttcagaaaag tacagaacaa atatgtcata   360
 361 catcaaataa ggatagataa aacagatgaa taa   393
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu