LOADING...
   ZP_02071672.1;SP17016A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02071672.1    SP17016A            JCSG 417984 PDB Deposition 13-NOV-21              PDB id: 2mhd

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02071672.1
DESCRIPTIONNMR structure of lipocalin like protein
ORGANISMBacteroides uniformis
COMMENTThis target is an orphan, so there is no Pfam family. Structure similarity search shows that target
belongs to Retinol binding protein-like
family.
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2MHD; Identical; 04-DEC-13; UNCHARACTERIZED PROTEIN;
DR FFAS; 409526; Fold and function assignment.
DR TVPC; ZP_02071672.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02071672.1; Ortholog view popup.
DR TPM; ZP_02071672.1; Target PDB monitor.
DR FSS; ZP_02071672.1; Target function coverage.
PROPERTY Residues: 132 aa
Molecule Weight: 15408.8 Dalton
Isoelectric Point: 4.95
Extinction Coefficient: 21430
Gravy Index: -.46
Number of Met residues: 4
Percentage of Met residues: 3.03 %
Number of Cys residues: 3
Percentage of Cys residues: 2.27 %
SEQUENCE  amino acids 132 aa
>ZP_02071672.1  gi|160890669|ref|ZP_02071672.1| hypothetical protein BACUNI_03114 [Bacteroides uniformis ATCC 8492]
MKTQNLFFMLILISMAFSFISCTDEDDKVEIPQLVGKWIVKEPVLQDDFVTCYTFNADKT
YEVYTGSPLSNGVPFRGTYIISLDEKLIKLYDKEEHCTEQYHILKLTSKEMKWENASPKD
GNSDKRLEKYND

CDS  cDNA 399 bp
   1 atgaaaacac aaaatttgtt ttttatgctg atactgataa gtatggcatt tagttttatt    60
  61 tcatgtacgg atgaggatga taaggtcgaa attcctcaac tggtaggtaa gtggattgtg   120
 121 aaagaaccag tcctgcagga cgattttgtg acctgctata cgtttaatgc agacaagacc   180
 181 tatgaagttt ataccggaag cccgttatct aacggagtcc cttttcgtgg aacttatatc   240
 241 ataagtcttg atgaaaaatt gattaagttg tatgataaag aggaacattg tactgaacaa   300
 301 tatcatattt tgaaactgac gtccaaggag atgaagtggg agaacgcatc gcccaaagac   360
 361 gggaattctg acaaacggct tgagaagtac aacgattaa   399
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu