LOADING...
   ZP_02071508.1;SP9087B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02071508.1    SP9087B            JCSG 417815 PDB Deposition 14-APR-21              PDB id: 4h4j, 4q5k, 4q68

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02071508.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides uniformis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF07313; DUF1460;
DR PDB; 4H4J; Identical; 17-OCT-12; HYPOTHETICAL PROTEIN;
DR PDB; 4Q68; Identical; 07-MAY-14; UNCHARACTERIZED PROTEIN;
DR PDB; 4Q5K; Identical; 21-MAY-14; UNCHARACTERIZED PROTEIN;
DR PDB; 2P1G; Highly similar; 20-MAR-07; PUTATIVE XYLANASE;
DR FFAS; 409210; Fold and function assignment.
DR TVPC; ZP_02071508.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02071508.1; Ortholog view popup.
DR TPM; ZP_02071508.1; Target PDB monitor.
DR FSS; ZP_02071508.1; Target function coverage.
PROPERTY Residues: 262 aa
Molecule Weight: 28887.71 Dalton
Isoelectric Point: 6.6
Extinction Coefficient: 31400
Gravy Index: -.2
Number of Met residues: 11
Percentage of Met residues: 4.20 %
Number of Cys residues: 3
Percentage of Cys residues: 1.15 %
SEQUENCE  amino acids 262 aa
>ZP_02071508.1  gi|160890505|ref|ZP_02071508.1| hypothetical protein BACUNI_02947 [Bacteroides uniformis ATCC 8492]
MKTMTKFMFSALCAAAMVTSVSAQGGKDMLSNGIKYLDVPYVAHTLEADGPEELVINCDE
VDCTTLVEYVLAETLTPKLADGDISESAFADNLQKIRYRDGKIDGYTSRLHYIADWINNG
VRNGFLQDVTGAMSPDTERLSISYMSSHPQLYKQLANSPENVAKMKKIEQSLSGKEVHYL
PKAKLPADGLPWIKDGDIIAITTNTPGLDVAHMGIAFYADNKLLLVHASSTDKKVVVSKV
PLSQMLKDNNKWTGIRVLRMKK

CDS  cDNA 789 bp
   1 atgaaaacaa tgactaaatt tatgttcagc gccctctgcg ccgcagccat ggtaacttcc    60
  61 gtttctgccc agggagggaa agatatgttg agcaatggaa taaagtatct ggatgtgcca   120
 121 tacgtagccc atacactgga ggcagatggt cccgaggaac tcgtcatcaa ctgcgatgag   180
 181 gtagactgca ccacgctggt ggaatatgtg ctggcagaga cactcactcc caaattagcc   240
 241 gacggggaca tctcggaaag cgctttcgcc gataacctgc aaaaaatccg ttaccgtgac   300
 301 ggtaaaatcg acgggtacac ttcccgcctg cattatattg ccgactggat aaacaatggc   360
 361 gtacgcaacg gcttccttca agatgtaacg ggcgccatga gtcccgacac cgaacggttg   420
 421 tctatctcct acatgtcttc ccatccccaa ctttacaagc agctggccaa ttcgccggag   480
 481 aacgtagcca aaatgaagaa gattgagcaa tccttgtccg gcaaggaagt tcactatctt   540
 541 cccaaagcca aacttcccgc cgatggtctc ccgtggatta aagacggcga tatcatagcc   600
 601 atcaccacca acactccggg gctggacgta gcccacatgg gaatcgcttt ctatgcggat   660
 661 aacaaactcc tgctggtaca cgcttcctct accgacaaga aagtggtcgt ctccaaagtc   720
 721 cccttgtccc aaatgctgaa agacaataat aagtggacgg gaatacgggt gctgaggatg   780
 781 aagaaataa   789
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu