LOADING...
   ZP_02071206.1;SP7807K
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02071206.1    SP7807K            JCSG 419950 PDB Deposition 14-MAR-12              PDB id: 4puc

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02071206.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides uniformis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4PUC; Identical; 04-JUN-14; SUSD HOMOLOG;
DR PDB; 3CGH; Highly similar; 18-MAR-08; SUSD HOMOLOG;
DR PDB; 4F53; Highly similar; 11-JUL-12; SUSD HOMOLOG;
DR PDB; 4MRU; Highly similar; 02-OCT-13; SUSD HOMOLOG;
DR PDB; 3GZS; Highly similar; 21-APR-09; UNCHARACTERIZED SUSD SUPERFAMILY PROTEIN;
DR PDB; 3SGH; Highly similar; 06-JUL-11; SUSD HOMOLOG;
DR PDB; 4F7A; Highly similar; 30-MAY-12; PUTATIVE UNCHARACTERIZED PROTEIN;
DR PDB; 3EHM; Highly similar; 12-MAY-09; SUSD HOMOLOG;
DR FFAS; 409318; Fold and function assignment.
DR TVPC; ZP_02071206.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02071206.1; Ortholog view popup.
DR TPM; ZP_02071206.1; Target PDB monitor.
DR FSS; ZP_02071206.1; Target function coverage.
PROPERTY Residues: 529 aa
Molecule Weight: 58557.43 Dalton
Isoelectric Point: 5
Extinction Coefficient: 114710
Gravy Index: -.36
Number of Met residues: 13
Percentage of Met residues: 2.46 %
Number of Cys residues: 3
Percentage of Cys residues: 0.57 %
SEQUENCE  amino acids 529 aa
>ZP_02071206.1  gi|160890203|ref|ZP_02071206.1| hypothetical protein BACUNI_02643 [Bacteroides uniformis ATCC 8492]
MKKKNIINKLIVAPLVMGFMSCTGNYMDINSNPYQPGDLTPDDYALGSAMSNLASTVISS
DVNTAQFTDCLLGGPLGGYFADSNAGWSNTISNFNATNDWTRVFLISDRIISTLYGNLST
VKQVSENTNNPVPYAIAQIIKVAAMSRVTDAYGPIPYSKIGQDGKITIPYDTQEEVYNAF
FKELDESIEVLTENRNAALVASADFVYSGNVQKWVKFANSLKLRLAIRIANVSPAKAKEM
AESAVNHELGLIETNADNATWKYFGTISNPLFVAVRYNEEASGGDTHPAADIICYMNGYN
DNRRASYFEESKWPGETYVGLRRGINLSKMKEYFINYSRVKISSSDPVLWMNAAEVAFLR
AEATAIYGFNMKGTAADFYEQGVRLSFEQWGATGVDSYLADESSVPALYKDPAGLNTYEK
NLSAITVKWNEGASKEEKQERIITQKWIANWPLGNEAWADYRRTGYPKLLPATSEGNLSG
GIVDSEKGARRMPYPSEEYTSNTENVQEAVNSYLGGPDNMATDVWWARK

CDS  cDNA 1590 bp
   1 atgaaaaaga aaaatattat aaataaattg attgttgctc cgttggttat gggctttatg    60
  61 tcctgtaccg gcaattatat ggatatcaac tccaatcctt atcaaccggg tgatttgact   120
 121 ccggatgatt atgcactggg ttctgccatg agtaacttgg caagtacggt tatctcatca   180
 181 gatgtcaata cggcacagtt tactgattgt ttgttgggtg gaccgttggg aggttatttt   240
 241 gccgattcaa atgccggctg gtccaataca atatccaatt ttaatgctac aaatgactgg   300
 301 acgcgtgtgt tcttgataag tgaccgtatc atttcaacac tttacggtaa cttgagcaca   360
 361 gtgaaacaag tatcggagaa taccaataat ccggttcctt atgccattgc tcaaatcata   420
 421 aaggttgctg ccatgagtcg cgtgactgat gcgtatggtc ctattcctta ttctaaaatc   480
 481 ggtcaggatg gcaagattac cattccttat gatacgcagg aagaagtata taacgcattc   540
 541 ttcaaggaac tggacgaatc catcgaggtg ctgactgaaa acagaaatgc ggcgttggtt   600
 601 gcttctgcag atttcgtgta cagtggtaat gtacagaagt gggtgaagtt tgccaattca   660
 661 ttgaaactgc gtttggctat ccgtattgcc aatgtaagcc ctgctaaggc taaagaaatg   720
 721 gctgaaagtg cagtgaatca cgagttgggt ctgattgaaa caaatgcaga caatgctaca   780
 781 tggaagtatt tcggtacaat tagcaatccg ttgtttgtgg cagtacgtta caatgaagaa   840
 841 gcttcaggtg gtgataccca tcctgctgcc gacatcatct gctacatgaa cggttacaac   900
 901 gacaatcgtc gtgccagcta ttttgaggaa tcaaaatggc ctggagagac ttatgtagga   960
 961 ttacgtcgcg gtatcaacct cagtaagatg aaagagtatt tcatcaatta ttcgcgtgtg  1020
1021 aagatttcct cttctgatcc cgtgctttgg atgaatgcgg cagaagttgc cttcttgcgt  1080
1081 gctgaagcca ctgcaatcta tggtttcaac atgaaaggaa ccgctgctga tttttatgaa  1140
1141 caaggtgtcc gtctctcttt cgaacagtgg ggagctaccg gtgtagacag ctatctggct  1200
1201 gatgaaagca gtgtacctgc tctttacaaa gatcccgccg gtcttaatac ttatgaaaag  1260
1261 aacctttcag ccattactgt caagtggaat gaaggggcat ccaaggaaga aaaacaggaa  1320
1321 cgtatcatta cccagaagtg gattgcgaat tggccgttag gtaacgaagc ttgggctgac  1380
1381 tatcgccgta caggctatcc caaactgttg cctgcaacca gtgaaggtaa cttgagtggt  1440
1441 ggaattgttg atagcgagaa aggtgcacgc cgtatgcctt atccttctga agaatataca  1500
1501 agtaatactg aaaacgtgca agaggcagta aacagctatc tgggtggacc ggacaacatg  1560
1561 gctactgacg tatggtgggc acgcaaataa  1590
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu