LOADING...
   ZP_02070184.1;SP17051A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02070184.1    SP17051A            JCSG 418017 PDB Deposition 14-MAR-25              PDB id: 4jqs, 4pxy

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02070184.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides uniformis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4JQS; Identical; 08-MAY-13; HYPOTHETICAL PROTEIN;
DR PDB; 4PXY; Identical; 23-APR-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 409570; Fold and function assignment.
DR TVPC; ZP_02070184.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02070184.1; Ortholog view popup.
DR TPM; ZP_02070184.1; Target PDB monitor.
DR FSS; ZP_02070184.1; Target function coverage.
PROPERTY Residues: 267 aa
Molecule Weight: 30702.4 Dalton
Isoelectric Point: 5.98
Extinction Coefficient: 67840
Gravy Index: -.34
Number of Met residues: 5
Percentage of Met residues: 1.87 %
Number of Cys residues: 2
Percentage of Cys residues: 0.75 %
SEQUENCE  amino acids 267 aa
>ZP_02070184.1  gi|160889181|ref|ZP_02070184.1| hypothetical protein BACUNI_01602 [Bacteroides uniformis ATCC 8492]
MKHLLILLFTACTLLTYAQVPEGYPANYAKAPRFKALIYYTQHAEEAHVQFAEQATTFFK
KLNYGDGFVLDITTDFSKYPYEKLKEYNVIIMLNTSPNTKAERDAFEQYMENGGGWVGFH
AAAYNDKNTHWPWFVKFLGGGVFYCNNWPPQPVLVEVDNEEHPVTKNLPASFVAPASEWY
QWTPSPRQNKDVEVLLSLSPKNYPLGIKDVVNFGDFPIVWSNKNYRMIYLNMGHGDEEFI
DGTQNLLLVNAFRWVVSKDKSGNPFLK

CDS  cDNA 804 bp
   1 atgaaacatc tgcttatttt attgtttacg gcttgcacct tgctgacgta cgcacaagtc    60
  61 cccgaaggtt atccggcaaa ctatgccaaa gctcctcgct tcaaggcctt gatttattac   120
 121 acgcaacatg cggaagaagc acacgtacaa tttgcagaac aagcaaccac tttcttcaag   180
 181 aagctcaatt acggtgacgg ctttgttctg gatattacta ccgatttttc aaaataccca   240
 241 tacgagaaac tgaaagaata caatgtcatt atcatgctta acacatcccc caacaccaag   300
 301 gccgaacgcg atgcttttga gcaatatatg gaaaacggag gcggttgggt aggtttccac   360
 361 gcagctgcct acaacgacaa aaacacgcat tggccctggt tcgttaagtt tcttggtggt   420
 421 ggggtgttct attgcaacaa ctggcctccc cagccggtat tggtcgaagt cgacaacgaa   480
 481 gaacatcccg ttaccaagaa tctgcctgca tcattcgtgg ctcccgccag cgaatggtac   540
 541 caatggactc ccagcccccg ccagaataag gacgtagaag tactcttgtc cctatcgccc   600
 601 aagaactatc cactgggtat caaggatgta gtgaattttg gcgacttccc catcgtatgg   660
 661 tccaacaaga attacagaat gatttacctg aatatggggc atggtgacga agagtttatc   720
 721 gacggtacac agaacctgct attagttaat gctttccgct gggtagtgag caaagacaaa   780
 781 agcggcaacc cgttcctcaa ataa   804
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu