LOADING...
   ZP_02069929.1;SP13538A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02069929.1    SP13538A            JCSG 417932 PDB Deposition 14-JUL-01              PDB id: 4qrl

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02069929.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides uniformis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4QRL; Identical; 27-AUG-14; HYPOTHETICAL PROTEIN;
DR FFAS; 409405; Fold and function assignment.
DR TVPC; ZP_02069929.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02069929.1; Ortholog view popup.
DR TPM; ZP_02069929.1; Target PDB monitor.
DR FSS; ZP_02069929.1; Target function coverage.
PROPERTY Residues: 135 aa
Molecule Weight: 15324.81 Dalton
Isoelectric Point: 7.59
Extinction Coefficient: 29910
Gravy Index: -.12
Number of Met residues: 3
Percentage of Met residues: 2.22 %
Number of Cys residues: 4
Percentage of Cys residues: 2.96 %
SEQUENCE  amino acids 135 aa
>ZP_02069929.1  gi|160888926|ref|ZP_02069929.1| hypothetical protein BACUNI_01346 [Bacteroides uniformis ATCC 8492]
MMKLHLKYLWIVLVACTLTACMNGGGDLAGKWQLRQYQYADGTSEKVDSVFYNFQKGSFS
AICLLKDGGLTTFFGNYSLKGAEISIILLPESVNDKNYDTYFGWPEGKCTFKVEDLSYSS
LRLEYEGTKSIFRKF

CDS  cDNA 408 bp
   1 atgatgaaat tgcatttaaa atatctttgg attgtattgg tggcttgtac tttgaccgct    60
  61 tgcatgaatg gtgggggtga cttggccggt aagtggcagt tgcgtcagta tcaatatgcc   120
 121 gacggtacat cagagaaggt ggacagtgta ttctataatt ttcaaaaagg aagtttttct   180
 181 gccatatgtt tgttgaaaga tggagggttg actacgtttt ttggaaatta ttctttgaaa   240
 241 ggtgctgaaa tttccattat tttgttgcct gaaagcgtta acgataaaaa ttatgatact   300
 301 tatttcgggt ggccggaagg aaaatgtacc tttaaagtag aagatttgtc ctactcttca   360
 361 ttgcgtttgg aatatgaggg cacgaaatct atttttcgaa aattttga   408
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu