LOADING...
   ZP_02069638.1;SP17061B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02069638.1    SP17061B            JCSG 419443 PDB Deposition 14-MAY-14              PDB id: 4qe0

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02069638.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides uniformis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4QE0; Identical; 09-JUL-14; HYPOTHETICAL PROTEIN;
DR FFAS; 409584; Fold and function assignment.
DR TVPC; ZP_02069638.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02069638.1; Ortholog view popup.
DR TPM; ZP_02069638.1; Target PDB monitor.
DR FSS; ZP_02069638.1; Target function coverage.
PROPERTY Residues: 204 aa
Molecule Weight: 23629.21 Dalton
Isoelectric Point: 5.19
Extinction Coefficient: 30370
Gravy Index: -.27
Number of Met residues: 9
Percentage of Met residues: 4.41 %
Number of Cys residues: 2
Percentage of Cys residues: 0.98 %
SEQUENCE  amino acids 204 aa
>ZP_02069638.1  gi|160888635|ref|ZP_02069638.1| hypothetical protein BACUNI_01052 [Bacteroides uniformis ATCC 8492]
MKRLLLITLLIGYIYPCVAQDKPIRTEESLEGTVIYKKTTTFEVDGYTYQCDVDDGSQFV
TLYNKENKLTYEKIVYKDTGKTYIGSWSSNVIEYDRFMSQQADFIVDQAFTKAMADEIGK
TELMITMLLSPNTGEVMEVNFNFFTFEPYAKVPLHVYREIEVKLKEQIHFKPIEEGKQLN
YIMLAWMQKPQGKLPPLPPPGSLM

CDS  cDNA 615 bp
   1 atgaaaagac tattgcttat tacactgctt ataggataca tctacccttg tgtagcacag    60
  61 gacaaaccta tcagaacaga agaatcactt gaaggaacag tcatttataa aaagaccacc   120
 121 actttcgagg tagatggtta tacgtaccaa tgcgacgtag atgacggtag ccagtttgtg   180
 181 actctttata acaaagaaaa caaactgaca tacgaaaaga ttgtgtataa agacacgggg   240
 241 aagacatata ttggcagctg gagtagcaat gtaattgaat atgacagatt catgagtcag   300
 301 caagcagatt tcatagtaga ccaagcattc accaaagcca tggcagatga aattgggaaa   360
 361 acggaactta tgataaccat gttgctcagt ccaaatacgg gagaagtaat ggaagtgaat   420
 421 ttcaattttt tcacctttga gccatacgcc aaagtgccac tacatgtata tagggaaatc   480
 481 gaagtaaaac tgaaagaaca aattcatttt aaacccatag aggaaggaaa acaactcaac   540
 541 tacattatgc tggcatggat gcaaaagccc caagggaaac tccccccatt acctcctccc   600
 601 ggttcgctaa tgtaa   615
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu