LOADING...
   ZP_02069618.1;SP16639C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02069618.1    SP16639C            JCSG 417980 PDB Deposition 14-FEB-19              PDB id: 2ml6

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02069618.1
DESCRIPTIONNMR structure of a cystatin-like protein,divergent member of PF14254, DUF4348
ORGANISMBacteroides uniformis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2ML6; Identical; 12-MAR-14; UNCHARACTERIZED PROTEIN;
DR PDB; 2ML5; Highly similar; 19-MAR-14; UNCHARACTERIZED PROTEIN;
DR PDB; 4R4K; Highly similar; 01-OCT-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 409522; Fold and function assignment.
DR TVPC; ZP_02069618.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02069618.1; Ortholog view popup.
DR TPM; ZP_02069618.1; Target PDB monitor.
DR FSS; ZP_02069618.1; Target function coverage.
PROPERTY Residues: 170 aa
Molecule Weight: 19765.02 Dalton
Isoelectric Point: 4.45
Extinction Coefficient: 25440
Gravy Index: -.5
Number of Met residues: 2
Percentage of Met residues: 1.18 %
Number of Cys residues: 2
Percentage of Cys residues: 1.18 %
SEQUENCE  amino acids 170 aa
>ZP_02069618.1  gi|160888615|ref|ZP_02069618.1| hypothetical protein BACUNI_01032 [Bacteroides uniformis ATCC 8492]
MKAIRFVFCLFAALMLTTLNGLAAEEEDFKTFLQKFTSSASFQYSRIKFPLKSPIALLKD
DGETEQTFPFTREKWALLDEETLKEGRTTEEEGGTYISHFTVNEPAHKEFEAGYDESEPS
LRVVFELTDGKWYVTDCYNDWYNFDLPINELEETIQAVQEENKAFEELHP

CDS  cDNA 513 bp
   1 atgaaggcta tccgctttgt tttttgtctg tttgcggcac tcatgctgac gactctcaat    60
  61 ggtctggctg ccgaagagga ggatttcaag acatttctcc agaaattcac gtccagtgct   120
 121 tcattccagt attcccgaat caagtttcct ttgaagtctc ccatcgccct cttgaaggat   180
 181 gacggtgaga cggaacagac ttttcccttc acccgcgaga agtgggcatt gctagacgaa   240
 241 gaaacgctga aggaaggacg tactaccgaa gaggagggag gtacctatat ttctcacttc   300
 301 actgtcaatg agcctgccca taaagagttc gaagcaggct atgatgaatc agaaccttcc   360
 361 cttcgtgtgg tctttgaact gacggatggc aagtggtatg tcaccgactg ctataacgac   420
 421 tggtacaact tcgatctccc tatcaatgaa ctggaagaaa ctattcaggc ggtacaagag   480
 481 gaaaacaagg ctttcgaaga acttcatcct tga   513
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu