LOADING...
   ZP_02069338.1;SP16828B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02069338.1    SP16828B            JCSG 417838 PDB Deposition 13-AUG-13              PDB id: 4m8k

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02069338.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides uniformis
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4M8K; Identical; 28-AUG-13; HYPOTHETICAL PROTEIN, GDSL-LIKE LIPASE/ACYLHYDROL PROTEIN;
DR PDB; 4NRD; Highly similar; 25-DEC-13; UNCHARACTERIZED PROTEIN;
DR FFAS; 409276; Fold and function assignment.
DR TVPC; ZP_02069338.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02069338.1; Ortholog view popup.
DR TPM; ZP_02069338.1; Target PDB monitor.
DR FSS; ZP_02069338.1; Target function coverage.
PROPERTY Residues: 239 aa
Molecule Weight: 27020.93 Dalton
Isoelectric Point: 5.44
Extinction Coefficient: 59360
Gravy Index: -.25
Number of Met residues: 3
Percentage of Met residues: 1.26 %
Number of Cys residues: 5
Percentage of Cys residues: 2.09 %
SEQUENCE  amino acids 239 aa
>ZP_02069338.1  gi|160888335|ref|ZP_02069338.1| hypothetical protein BACUNI_00748 [Bacteroides uniformis ATCC 8492]
MNCKSLFFLVVFSLTLISGVFAQKKVSILGDSYSTFYGHVSPAANLCWYGVPGEKKENDV
TKVEETWWYRFIHEHGFQLERNNSYSGSTVCHTGYEKADYSDRSFITRIHNLGTPDIILV
FGGTNDSWAGAPIGAYQYDGWTKADLYSFRPAFCYLLASLKQLYPAARIYNITNSELSEE
VTDSMDEICRHYGIENIRLHDIDKQWGHPSVQGMQSIDAQVWESVSPILEASVSLPAKN

CDS  cDNA 720 bp
   1 atgaactgca aatccttgtt ttttctggtt gttttttccc tgacccttat atcaggggtg    60
  61 tttgctcaaa agaaagtttc tattcttggc gattcctatt ccacttttta cggtcatgtc   120
 121 tctcctgccg ccaatctctg ctggtatgga gttcccggcg aaaagaaaga gaatgatgtg   180
 181 acaaaggtgg aggaaacctg gtggtaccgt ttcatccatg agcacggctt tcagttggaa   240
 241 cgcaacaatt cctattccgg ctccaccgtc tgtcataccg gttacgagaa agccgattac   300
 301 tccgaccgtt cttttatcac ccgtattcac aacctcggca cccccgacat aatccttgtt   360
 361 tttggcggta ccaatgacag ttgggcaggt gctcccattg gcgcatacca atatgatggc   420
 421 tggacgaaag ccgatttgta tagcttccgt cctgcctttt gctatctgct tgcatctctc   480
 481 aagcagctct atcctgcggc caggatttat aatattacca attcagaatt atccgaagag   540
 541 gtaactgatt ccatggatga aatttgccgg cactatggca tcgagaatat tcgtttgcac   600
 601 gacattgata aacaatgggg gcatccttct gtgcaaggaa tgcagagtat cgatgctcag   660
 661 gtttgggagt ctgtctcccc gatattggag gcttctgttt ctttgcctgc caagaactaa   720
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu