LOADING...
   ZP_02068317.1;SP13500A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02068317.1    SP13500A            JCSG 416998 PDB Deposition 14-MAY-19              PDB id: 4qey

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02068317.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides ovatus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4QEY; Identical; 16-JUL-14; UNCHARACTERIZED PROTEIN;
DR PDB; 3U6G; Highly similar; 02-NOV-11; UNCHARACTERIZED PROTEIN DUF4425;
DR PDB; 2LRG; Highly similar; 18-APR-12; UNCHARACTERIZED PROTEIN;
DR FFAS; 408357; Fold and function assignment.
DR TVPC; ZP_02068317.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02068317.1; Ortholog view popup.
DR TPM; ZP_02068317.1; Target PDB monitor.
DR FSS; ZP_02068317.1; Target function coverage.
PROPERTY Residues: 155 aa
Molecule Weight: 16636.97 Dalton
Isoelectric Point: 5.26
Extinction Coefficient: 7450
Gravy Index: -.13
Number of Met residues: 3
Percentage of Met residues: 1.94 %
Number of Cys residues: 3
Percentage of Cys residues: 1.94 %
SEQUENCE  amino acids 155 aa
>ZP_02068317.1  gi|160887314|ref|ZP_02068317.1| hypothetical protein BACOVA_05332 [Bacteroides ovatus ATCC 8483]
MKKRILSLLGVIALFLGVILVSCGNDDDNKNTTGVHKIVVEQSGNTDDFDLNIAFGAANT
GGVAKLYNENGEYLGDSYLVNKVTENKISCQTGKEGSMMTCAGSVISTSEQAGKKLKISV
IAYIDNKEVNRLEKEYITKGSTLVENFSVSTTSVE

CDS  cDNA 468 bp
   1 atgaagaagc gaatattatc attattaggc gtaattgccc tatttttagg agtcatccta    60
  61 gttagctgtg gaaacgatga cgataataaa aacacaacag gagtacacaa aattgttgta   120
 121 gagcagtcgg gaaatacaga cgattttgat ctgaatatcg cattcggagc agccaacacc   180
 181 ggtggagttg caaaactata caatgaaaat ggcgaatatt taggtgactc atacttggta   240
 241 aataaagtga cagaaaataa gattagctgc cagacaggta aagaaggttc catgatgact   300
 301 tgtgcaggat cagtaataag tacatcagaa caagcaggca aaaaactaaa aatttctgtt   360
 361 attgcctata tagacaacaa agaggttaac cgcttagaaa aagaatacat aacgaaaggt   420
 421 agtacattag tagagaattt cagtgtatca actacaagtg tagaataa   468
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu