LOADING...
   ZP_02067971.1;ZP_02067971.1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02067971.1    SP16984B            JCSG 429784 PDB Deposition 12-APR-17

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02067971.1
DESCRIPTIONfimbrial protein, Ig-like sandwich fold
ORGANISMBacteroides ovatus
COMMENTA new type of bacterial fimbriae shows an unique mechanism of assembly: removal of the first N-terminal β-strand of fimbrillin by an
arginine/lysine-specific proteinase uncovers a hydrophobic groove that extends along the fimbrillin length and is filled by two C-terminal
donor strands of the incoming fimbrillin
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4EPS; Identical; 13-JUN-12; HYPOTHETICAL PROTEIN;
DR FFAS; 408414; Fold and function assignment.
DR TVPC; ZP_02067971.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02067971.1; Ortholog view popup.
DR TPM; ZP_02067971.1; Target PDB monitor.
DR FSS; ZP_02067971.1; Target function coverage.
PROPERTY Residues: 534 aa
Molecule Weight: 59657.58 Dalton
Isoelectric Point: 4.77
Extinction Coefficient: 92140
Gravy Index: -.38
Number of Met residues: 14
Percentage of Met residues: 2.62 %
Number of Cys residues: 7
Percentage of Cys residues: 1.31 %
SEQUENCE  amino acids 534 aa
>ZP_02067971.1  gi|160886968|ref|ZP_02067971.1| hypothetical protein BACOVA_04982 [Bacteroides ovatus ATCC 8483]
MKQYKLMQVALLAILLFGWAGCSQNEEEVPGNVRNGIVLNVTDTGIISNEPSTRTEDTGF
VTTFTQGDQIGLFAVKDGAILDEINNMPFTFNGSSWSGKPILYDDRLVGVNFYAYYPYQS
EMTGKTDLIGDDFFAPLAAGWELTTEQSDQKAYAKQDLMTSNATALIGENGNYSLSFQLT
HRMSLVVVKLPSTRYIFTDAEGVAMPEETPYVAMSVDVAFYLDNVEEGTKISPYYDAKKD
EYRLLRKPSSENQIIGHYNDKQCTLDTAEKMKEGKYKRFVVDGGYKEVTHHLQVGDYYYA
DGSVVSGNEAEPAKDNCIGIVCWVGNPMPSVLYKDVAGTPYTATNDALLRSHPNCVHGLV
MSLYTETGKFSPALTQSIHDWFMTTSFTSSYVSVTGYYDANENNKNKPLRFLGYNNSEVL
DLYYDTFKTDFECFQYQDDCESSFPSPSITTGWYVPSSGELVALQDKDNSLESKLNTKLI
KVSDKTMDISATYWSSTERNNKNMYIVTYSKTAGSAGTGGVKTNTYTYRFFLGF

CDS  cDNA 1605 bp
   1 atgaaacaat ataaacttat gcaagtggcc ttgctggcaa tcctattgtt cggttgggct    60
  61 ggttgttctc aaaatgagga agaagttccg ggaaatgtac ggaatgggat tgtactgaac   120
 121 gtgactgata cagggataat tagcaatgaa ccgtctacgc gtacagaaga tacgggattc   180
 181 gtcacgacct ttacacaagg cgaccagatt ggactgttcg ccgtgaaaga cggtgcgata   240
 241 ttggacgaaa tcaataatat gcctttcact ttcaatggtt cgagctggtc gggtaaaccg   300
 301 atattgtatg atgatcgtct ggtgggagtg aatttctatg cttactatcc ttatcaatcg   360
 361 gaaatgacag gaaaaacgga tttgataggt gatgattttt ttgctcctct ggcagccggt   420
 421 tgggaattga caacagaaca aagtgatcag aaagcatatg cgaaacagga tttgatgacc   480
 481 tcaaatgcaa ctgcattgat tggtgagaac ggaaactact cattgagctt tcagttaaca   540
 541 caccgtatga gcttggttgt tgtgaagttg ccttccactc gttatatctt tacagatgcc   600
 601 gaaggagtgg caatgccgga agaaactcct tatgttgcta tgtctgtcga tgtagctttt   660
 661 tatcttgata atgtggagga aggaactaaa atttctcctt attatgacgc aaagaaagat   720
 721 gaatatcgtt tgctaagaaa accgtcttcg gaaaatcaga ttatcggtca ttataatgat   780
 781 aagcaatgta cgcttgatac ggctgaaaag atgaaagaag gaaaatacaa acgttttgtt   840
 841 gtcgatggtg gatataaaga ggtgacccat catctgcagg taggcgatta ttattatgca   900
 901 gatggaagtg tggtaagtgg caatgaagca gaacctgcaa aggataattg tattggaatc   960
 961 gtttgttggg tgggaaatcc gatgccttct gtgttgtata aagatgtggc gggaactccc  1020
1021 tatactgcca ctaatgatgc attgctccgt tcgcatccca attgtgttca tgggttagtt  1080
1081 atgagcctct atacagaaac gggcaaattc tctcctgctc ttactcaaag tatacacgac  1140
1141 tggtttatga ctacttcgtt tacttcttct tatgtatctg ttaccggata ttatgatgca  1200
1201 aatgaaaata ataaaaacaa acctcttcgc tttttgggat ataacaactc ggaagtatta  1260
1261 gatttgtact acgatacttt caaaacagat tttgaatgtt tccaatatca ggatgattgt  1320
1321 gaaagtagct tcccgtctcc gtctataact accggttggt atgtgccttc cagtggggaa  1380
1381 cttgttgctt tgcaggataa agataattct ttagagagta agctgaatac taagttgata  1440
1441 aaagtatcgg ataaaacaat ggatatatct gctacctatt ggagtagtac ggaacggaat  1500
1501 aataagaata tgtacattgt tacttattct aaaacagctg gctcggcagg aaccggtggt  1560
1561 gtcaagacca atacttacac ttatcgtttt ttcctgggat tctaa  1605
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu