LOADING...
   ZP_02067944.1;SP16828A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02067944.1    SP16828A            JCSG 416777 PDB Deposition 13-NOV-26              PDB id: 4nrd

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02067944.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides ovatus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4NRD; Identical; 25-DEC-13; UNCHARACTERIZED PROTEIN;
DR PDB; 4M8K; Highly similar; 28-AUG-13; HYPOTHETICAL PROTEIN, GDSL-LIKE LIPASE/ACYLHYDROL PROTEIN;
DR FFAS; 408189; Fold and function assignment.
DR TVPC; ZP_02067944.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02067944.1; Ortholog view popup.
DR TPM; ZP_02067944.1; Target PDB monitor.
DR FSS; ZP_02067944.1; Target function coverage.
PROPERTY Residues: 228 aa
Molecule Weight: 26560.8 Dalton
Isoelectric Point: 6.21
Extinction Coefficient: 51340
Gravy Index: -.38
Number of Met residues: 7
Percentage of Met residues: 3.07 %
Number of Cys residues: 6
Percentage of Cys residues: 2.63 %
SEQUENCE  amino acids 228 aa
>ZP_02067944.1  gi|160886941|ref|ZP_02067944.1| hypothetical protein BACOVA_04955 [Bacteroides ovatus ATCC 8483]
MKKSFYLLLLITLYSSISFAQSLKSISILGDSYSTFEGYLQPDTNSIWYYVSPRQQTDVT
SVKQTWWHKFIKENNYRLCVNNSFSGATICNTGYNQADYSDRSFITRMDKLGCPDIIFIF
GATNDCWAGSPLGDYKYEGWTKEDLYTFRPAMAYLLDHMIDRYPNVEIYFLLNSGLKEEF
NESVRAICNHYNIDCIELHDIDKKSGHPSIKGMEQISEQIKMFMRKTK

CDS  cDNA 687 bp
   1 atgaagaaat ccttttattt attactgcta atcactctat atagcagtat cagctttgct    60
  61 caaagcctga aatctatatc tattttaggc gattcgtatt caacatttga aggatacctg   120
 121 caacccgata ccaatagcat ttggtattat gtttctccgc gacagcaaac ggatgtaact   180
 181 tccgtaaagc agacctggtg gcataaattc atcaaagaga ataactaccg cctttgtgtc   240
 241 aacaactctt tttccggtgc aacgatttgt aataccggtt ataatcaggc tgattattcg   300
 301 gatcgttctt ttattacccg tatggataag ctgggatgtc cggatatcat ctttattttc   360
 361 ggtgcaacga atgattgttg ggccggctca ccgcttgggg attacaagta tgaagggtgg   420
 421 accaaggaag atttatatac attccgtccg gctatggcat atctgcttga ccacatgatt   480
 481 gatcgttatc ctaatgttga aatctacttt ctgctgaact ctggtttaaa ggaagagttt   540
 541 aatgaatcag tcagagctat ctgcaatcac tataacattg attgtattga actgcatgat   600
 601 attgacaaaa agagcggtca tccttcgata aaggggatgg agcagattag tgaacagatt   660
 661 aagatgttta tgaggaagac gaagtga   687
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu