LOADING...
   ZP_02067350.1;SP13839C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02067350.1    SP13839C            JCSG 419057 PDB Deposition 15-MAY-12              PDB id: 4zrx

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02067350.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides ovatus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00754; F5_F8_type_C;
DR PDB; 3UES; Highly similar; 04-APR-12; ALPHA-1,3/4-FUCOSIDASE;
DR PDB; 3MO4; Highly similar; 12-MAY-10; ALPHA-1,3/4-FUCOSIDASE;
DR PDB; 3UET; Highly similar; 04-APR-12; ALPHA-1,3/4-FUCOSIDASE;
DR PDB; 3EYP; Highly similar; 04-NOV-08; PUTATIVE ALPHA-L-FUCOSIDASE;
DR PDB; 4OUE; Highly similar; 26-FEB-14; PUTATIVE LIPOPROTEIN;
DR PDB; 4OZO; Highly similar; 05-MAR-14; PUTATIVE LIPOPROTEIN;
DR FFAS; 408179; Fold and function assignment.
DR TVPC; ZP_02067350.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02067350.1; Ortholog view popup.
DR TPM; ZP_02067350.1; Target PDB monitor.
DR FSS; ZP_02067350.1; Target function coverage.
PROPERTY Residues: 605 aa
Molecule Weight: 68695.58 Dalton
Isoelectric Point: 7.62
Extinction Coefficient: 129260
Gravy Index: -.48
Number of Met residues: 15
Percentage of Met residues: 2.48 %
Number of Cys residues: 4
Percentage of Cys residues: 0.66 %
SEQUENCE  amino acids 605 aa
>ZP_02067350.1  gi|160886347|ref|ZP_02067350.1| hypothetical protein BACOVA_04357 [Bacteroides ovatus ATCC 8483]
MNKLLTSLLLSVTLMSGAQAQKKENYYVKHVEFPQSATIEQKVDMAARLVPTPQQYAWQQ
MELTAFLHFGINTFTGREWGDGKEDPALFNPSELDAEQWVRTLKEAGFKMVLLTAKHHDG
FCLWPTATTKHSVASSPWKNGQGDVVKELRAACDKYDMKFGVYLSPWDRNAECYGDSPRY
NDFFIRQLTELLTNYGEVHEVWFDGANGEGPNGKKQVYDWDAFYQTIQRLQPKAVMAIMG
DDVRWVGNEKGVGRETEWNATVLTPGIYARSQENNKRLGVFSKAEDLGSRKILEKATELF
WYPSEVDVSIRPGWFYHAEEDGKVKSLKHLSDIYFQSVGYNSVLLLNIPPDRRGLIHEAD
IKRLKEFADYRQQTFADNRVKNGRKYWSTTSGGEAVYALKSKSEINLVMLQEDITKGQRV
EAFTVEALTDNGWKEVGKGTTIGYKRMLRFPAVNANKLRVRIDECRLTAYVSQVAAYYAE
PLQEETTKEDWNNLPRSGWKQVAASPLTIDLGKTVTLSSFTYAPSKAEVKPTMAFRYQFF
VSMDGKSWKEVPASGEFSNIMHNPLPQTVAFSQKVQARFIKLEATTPDATVAKVNMNEIG
VMVIP

CDS  cDNA 1818 bp
   1 atgaataaac tactaacctc tcttttattg tctgttactc tcatgagtgg agcgcaggcg    60
  61 cagaaaaaag aaaattacta tgtgaagcat gttgaatttc ctcaaagtgc aactatcgaa   120
 121 cagaaggttg atatggcagc gcgtctggta cctactccac agcaatacgc ttggcaacaa   180
 181 atggaattaa cagctttcct tcattttggt atcaacacct ttaccggacg tgaatggggg   240
 241 gacgggaaag aagatcccgc gctctttaat ccttcggaac tggatgctga acaatgggta   300
 301 cgtaccctca aggaagccgg ctttaaaatg gtgcttctga ctgcaaaaca tcacgacggt   360
 361 ttctgccttt ggccaacggc tactaccaaa cattccgtgg cctcttctcc ttggaaaaac   420
 421 ggacaaggcg atgtagtgaa agaacttcgt gctgcctgtg acaaatatga tatgaagttt   480
 481 ggagtatatc tttctccctg ggaccggaat gcggaatgtt atggagactc tccccgttac   540
 541 aatgattttt ttattcggca attgacggaa ttgctcacca attatggtga agtacatgaa   600
 601 gtctggttcg acggggcgaa tggagaaggt ccgaacggaa agaagcaagt gtatgactgg   660
 661 gacgcttttt accaaaccat ccaacgcctc caacccaaag ctgtgatggc aattatgggg   720
 721 gatgatgtcc gctgggtcgg aaacgagaaa ggagtaggcc gtgaaacgga atggaacgca   780
 781 actgtgttga ctcccggtat atatgcccgt tcacaagaga acaacaaacg tttgggtgtt   840
 841 ttcagtaaag cagaggattt gggaagtcgt aagatattgg agaaagctac ggaattattc   900
 901 tggtatcctt cggaagtcga cgtatctatc cgtccgggat ggttctatca tgcggaggaa   960
 961 gatggtaaag tgaaatcttt gaagcattta tcagatattt atttccagtc ggtaggatat  1020
1021 aattcagtgc ttctactgaa tattccacct gaccggaggg gactgattca tgaagctgat  1080
1081 atcaagcggt tgaaagagtt tgctgattat cggcaacaaa cgtttgctga caaccgggtg  1140
1141 aaaaacggaa gaaaatactg gagcactact tcgggcggtg aggctgtcta tgccttgaag  1200
1201 tccaaatcgg aaatcaatct ggtcatgttg caggaagata taacgaaagg gcagagggta  1260
1261 gaggctttta ctgtggaagc cttgacggat aatggctgga aagaagtagg aaaaggtacg  1320
1321 acgataggat ataaacgtat gttgcgcttt ccggcagtta atgccaataa gctccgggtg  1380
1381 agaatagacg agtgccggtt gactgcttac gttagtcagg ttgccgctta ttatgcagaa  1440
1441 cctttgcagg aagaaacaac gaaagaagac tggaataatt tgccgcgttc cggatggaaa  1500
1501 caggttgctg cttctccatt aacgattgat ttggggaaga cggtaacatt gagcagtttc  1560
1561 acgtacgcgc cttcaaaagc ggaggtaaag ccgacgatgg cattccgtta tcaattcttt  1620
1621 gtaagcatgg atggtaagag ctggaaagaa gtgcctgcca gtggagagtt cagcaatatt  1680
1681 atgcataatc cgttgccaca gacggttgct ttcagtcaga aagtacaggc acgtttcatt  1740
1741 aaactggagg ccactacacc tgatgctacc gttgctaaag taaatatgaa tgaaataggg  1800
1801 gtgatggtga ttccctga  1818
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu