LOADING...
   ZP_02067300.1;SP13297B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02067300.1    SP13297B            JCSG 416956 PDB Deposition 14-FEB-11              PDB id: 4orl

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02067300.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides ovatus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4ORL; Identical; 05-MAR-14; UNCHARACTERIZED PROTEIN;
DR PDB; 4OUQ; Highly similar; 30-APR-14; UNCHARACTERIZED PROTEIN;
DR PDB; 4Q53; Highly similar; 16-JUL-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 408309; Fold and function assignment.
DR TVPC; ZP_02067300.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02067300.1; Ortholog view popup.
DR TPM; ZP_02067300.1; Target PDB monitor.
DR FSS; ZP_02067300.1; Target function coverage.
PROPERTY Residues: 130 aa
Molecule Weight: 14570.24 Dalton
Isoelectric Point: 10.06
Extinction Coefficient: 2980
Gravy Index: -.24
Number of Met residues: 5
Percentage of Met residues: 3.85 %
Number of Cys residues: 1
Percentage of Cys residues: 0.77 %
SEQUENCE  amino acids 130 aa
>ZP_02067300.1  gi|160886297|ref|ZP_02067300.1| hypothetical protein BACOVA_04304 [Bacteroides ovatus ATCC 8483]
MKKRVLVGMTALLLSLSLLMAQEIPAGVITAFKRGSSQELSKYMGDKVNLVFQGRSTNVD
KQKATAAMQEFFTKNKVSGFNVNHQGKRDESSFVIGTLATTNGNFRVNCFLKKVQNQYLI
HQIRIDKINE

CDS  cDNA 393 bp
   1 atgaaaaaac gagtgctcgt aggaatgacc gcattgcttc tttccctctc gttgctaatg    60
  61 gcgcaagaga taccggcagg agtgattacg gcatttaaaa gaggaagctc gcaagagcta   120
 121 agtaagtata tgggggacaa ggtaaacctg gtgttccaag gtcgctcgac aaacgttgac   180
 181 aaacagaaag caacagctgc gatgcaggaa ttctttacga agaataaagt cagcggattt   240
 241 aacgtgaacc atcagggaaa acgggacgaa tcaagtttcg ttatcggtac gttggctact   300
 301 actaatggga actttcgtgt gaactgcttc ctgaagaaag tgcagaatca atatttaata   360
 361 catcaaataa gaattgacaa gatcaatgaa taa   393
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu