LOADING...
   ZP_02067074.1;SP17169A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02067074.1    SP17169A            JCSG 417104 PDB Deposition 11-NOV-17              PDB id: 3up6

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02067074.1
DESCRIPTIONPutative cell adhesion protein, PF06321, Major fimbrial subunit protein, a periodontopathogen, play an important role in its adhesion to and
invasion of host cells.
ORGANISMBacteroides ovatus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 3UP6; Identical; 21-DEC-11; HYPOTHETICAL PROTEIN BACOVA_04078;
DR FFAS; 408606; Fold and function assignment.
DR TVPC; ZP_02067074.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02067074.1; Ortholog view popup.
DR TPM; ZP_02067074.1; Target PDB monitor.
DR FSS; ZP_02067074.1; Target function coverage.
PROPERTY Residues: 370 aa
Molecule Weight: 40250.06 Dalton
Isoelectric Point: 4.67
Extinction Coefficient: 31400
Gravy Index: -.08
Number of Met residues: 9
Percentage of Met residues: 2.43 %
Number of Cys residues: 2
Percentage of Cys residues: 0.54 %
SEQUENCE  amino acids 370 aa
>ZP_02067074.1  gi|160886071|ref|ZP_02067074.1| hypothetical protein BACOVA_04078 [Bacteroides ovatus ATCC 8483]
MRKKLLHIIYLASTILLFSCSREADVAYELPAHTTRAQLSIDLVNNGDVEQQEKINSMRF
IVFGSTPGGVRLDVNEHILLSTPETATDIDAQLLEVTSSNDILVVVIANEPQSLTSQLDG
IANLLTLQEMIYDISSILNSDGQIISATGMPMTGVIRDISIAPDETKTVQMVIERAVARV
DVFIEAIDGGAVTGYTAGSTSVTLHNFSHDSYFVMGNVGNGTRDNADSSKNYGKVKEDVS
ESNLLTHSWTAATTETWAYSSAPGAENRKLLCSFYTAERLFKSDYSDRLSISMANVLKGP
SDVTGITGKVIESVTKVDGTGSPTAQPFTEIRRNNVYQVTARVGKIGIQILTISVEDWGE
RQDIDLDMDL

CDS  cDNA 1113 bp
   1 atgagaaaaa agctattaca tatcatttat ctggcatcca ccatcctttt gttctcatgt    60
  61 agtagagaag ctgatgtggc ttatgagttg cctgcccata ctacccgggc gcaacttagc   120
 121 atcgacttgg tgaacaatgg ggatgtggaa caacaggaga agataaactc catgcggttt   180
 181 atcgtattcg gcagcacgcc cggtggcgtg aggctggatg tgaatgaaca catcctgttg   240
 241 agcactccgg agacagctac tgatatagat gcgcaacttc tcgaagtgac ttccagcaat   300
 301 gatatcctgg tcgtagttat tgccaacgaa ccgcagagtc tcacaagcca acttgacggt   360
 361 atagctaatc ttttgacgtt gcaagagatg atttacgaca tctccagcat actgaatagt   420
 421 gacgggcaga ttatttcggc gaccggaatg cctatgacag gagtgatccg ggatatatcc   480
 481 atagcacccg atgaaaccaa aacagtgcaa atggtaatcg aacgtgccgt agcccgggta   540
 541 gatgtcttta tcgaagctat agacggcggg gcagtgaccg gatatactgc cggaagcacc   600
 601 agtgtcacct tgcataattt ttcccacgat agctatttcg tgatgggaaa tgtgggcaac   660
 661 ggcacgcgtg ataacgccga ctcttcaaaa aactacggaa aggtgaagga agacgtgtcg   720
 721 gaaagcaatt tattaacgca tagctggacg gctgcgacta cagaaacttg ggcatactca   780
 781 tcggctcccg gagctgaaaa ccggaagttg ctttgctcgt tctacacagc cgaacgccta   840
 841 ttcaagtcgg attattccga ccgactgtct atcagtatgg ctaatgtcct aaaagggcct   900
 901 tcggacgtca ccggaataac cgggaaagta attgaaagcg taacaaaggt tgacggcaca   960
 961 ggtagtccga cagcgcaacc ttttacggag atccgtcgga acaacgtgta tcaggtaacg  1020
1021 gcacgcgtag gaaaaatagg tattcagata ctgacgataa gcgtagaaga ttggggtgaa  1080
1081 agacaagaca ttgatttgga tatggacttg taa  1113
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu