LOADING...
   ZP_02066560.1;SP8524C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02066560.1    SP8524C            JCSG 416724 PDB Deposition 12-FEB-15              PDB id: 4dqa

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02066560.1
DESCRIPTIONPutative carbohydrate binding protein, two domains structure, Laminin_G_3 Concanavalin A-like
lectin/glucanases superfamily Domain (PF13385)
ORGANISMBacteroides ovatus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF08522; DUF1735;
DR PDB; 4DQA; Identical; 21-MAR-12; UNCHARACTERIZED PROTEIN;
DR FFAS; 408069; Fold and function assignment.
DR TVPC; ZP_02066560.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02066560.1; Ortholog view popup.
DR TPM; ZP_02066560.1; Target PDB monitor.
DR FSS; ZP_02066560.1; Target function coverage.
PROPERTY Residues: 380 aa
Molecule Weight: 41953.11 Dalton
Isoelectric Point: 4.96
Extinction Coefficient: 61770
Gravy Index: -.18
Number of Met residues: 14
Percentage of Met residues: 3.68 %
Number of Cys residues: 1
Percentage of Cys residues: 0.26 %
SEQUENCE  amino acids 380 aa
>ZP_02066560.1  gi|160885557|ref|ZP_02066560.1| hypothetical protein BACOVA_03559 [Bacteroides ovatus ATCC 8483]
MMNKHIFYYLMVGSMALLLGACNDSMNDLLEPKVYFESKEYNFSVEDEMDVMTFDLVSRL
SSATSSQVDVSYSVAEPSVVDEYNAKYGTNYEMLDVSQVKLSSTTSSISSGKLYADNIEV
ELSGLEALKAGNSYVLPMRVHSSSVSTLSGTNIAYFFFSKPLKITKAGNFSNHYISVKFP
VGTFFSSFTYEALINVDYFLDNNTIMGTEGVMILRIGDAGGGITPKDYLEVAGGQNYRVT
KPLLTNRWYHVALTYDQPTGKTGIYVNGEKWAGSDWGIDGFDPNSDMGFYIGRIYGFKWG
ERPFHGKMSEVRVWSVARTENQLKQNMLGVDPASEGLALYYKLDGSETQEGGVIKDATGR
INGTTNGITIKTLDAPIAIN

CDS  cDNA 1143 bp
   1 atgatgaata aacatatatt ctattatttg atggtaggta gtatggcgtt attgttgggc    60
  61 gcttgcaacg acagcatgaa tgacctgctg gagcctaagg tttatttcga aagcaaggaa   120
 121 tataatttct cggtggaaga tgaaatggat gtaatgacat ttgatctggt ttcaagactc   180
 181 tcgtcagcaa cttcctctca ggtagacgta tcatatagtg tagccgaacc aagtgtagta   240
 241 gacgaataca atgcaaagta tggcacaaat tatgagatgc ttgatgtttc gcaggtaaag   300
 301 ctaagcagta cgacatcttc tatttcgagt ggaaaattgt atgcggataa tatagaagtc   360
 361 gaactttccg ggttagaagc cttgaaagcc gggaactcat atgttttgcc tatgcgggtg   420
 421 cattcgtctt cggtgtcgac tctttccgga acaaacattg catatttctt tttctccaaa   480
 481 ccgttgaaaa ttaccaaagc tggtaatttc agtaaccact atatttctgt gaagttccct   540
 541 gtcggtactt tcttctcgtc attcacttac gaagcattga ttaatgtgga ttatttcctc   600
 601 gataataata cgattatggg aaccgaaggt gtgatgattc tccgtatcgg tgatgcagga   660
 661 ggaggaatta ctcctaaaga ttatttggaa gtggccggag gacagaacta ccgtgtaacg   720
 721 aaaccgttgt taacaaatcg ttggtatcat gtagcgttga cttatgatca accgacagga   780
 781 aaaacaggta tttatgtaaa tggtgagaaa tgggctggtt cagattgggg tattgacggt   840
 841 tttgatccga attcggacat gggtttttat attggtagaa tctatggttt taaatggggt   900
 901 gaacgtccat tccatggtaa aatgagtgaa gtccgtgttt ggagtgtagc ccgtacggaa   960
 961 aatcaactta agcagaatat gctgggtgtt gaccctgctt cagaaggctt ggcactttat  1020
1021 tataaactag acggatcaga gactcaggaa ggtggagtta tcaaagatgc cacagggcgt  1080
1081 ataaacggta ctacaaatgg aattactatt aagacgttgg atgctccgat agctatcaat  1140
1141 taa  1143
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu