LOADING...
   ZP_02065691.1;C.KN13612A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02065691.1    C.KN13612A            JCSG 425227 PDB Deposition 15-JUN-29              PDB id: 5cag

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02065691.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides ovatus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 425227; Fold and function assignment.
DR TVPC; ZP_02065691.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02065691.1; Ortholog view popup.
DR TPM; ZP_02065691.1; Target PDB monitor.
DR FSS; ZP_02065691.1; Target function coverage.
PROPERTY Residues: 317 aa
Molecule Weight: 34857.49 Dalton
Isoelectric Point: 4.57
Extinction Coefficient: 41370
Gravy Index: -.45
Number of Met residues: 7
Percentage of Met residues: 2.21 %
Number of Cys residues: 5
Percentage of Cys residues: 1.58 %
SEQUENCE  amino acids 317 aa
>ZP_02065691.1  gi|160884688|ref|ZP_02065691.1| hypothetical protein BACOVA_02677 [Bacteroides ovatus ATCC 8483]
MLTGCSRRDILDDYPVSGVDIKLDWDGVTDQLPEGVRVIFYPKNGDGRKVDKYLSVRGGE
MKVPPGRYSVVVYNYNTESIRIRGEESYETIEAYTGNCNGLGIEGTEKMVWSPDSLYVLN
IDELKIEKSEEVLRLDWKLESVVKKYSFAVEAKGLEYVATVVGSIDGLSDCYCIGKGRGV
CSSQPIYFEVKKGDNKVTAFFTAFKQVKEMTMPTRMSTSERETSSEKGAIILILKFIKTD
NTVQEATIDVTEIIGTLENAGTGEDGKPTPPPEIELPPDDKIEVDKPETPPNPDGGGGMG
GNVDGWGPEDNVELPVN

CDS  cDNA 954 bp
   1 atgctaactg gatgtagccg tcgcgatata ttggatgatt atcccgtaag tggggtagat    60
  61 ataaagctgg attgggatgg agtgacagat caactgccgg agggagttcg ggtgattttt   120
 121 tatccgaaga acggggatgg caggaaagta gataagtacc tttcggtacg aggcggagaa   180
 181 atgaaagttc ctccgggacg gtattcggta gtagtctaca actataacac ggaatctata   240
 241 cgaatcaggg gtgaagagtc ctatgaaacg atagaagcct acacgggaaa ctgcaatggt   300
 301 ttagggattg aaggaacgga aaagatggtt tggtcaccgg attcattgta tgtgttgaat   360
 361 atagatgagc tgaaaataga gaagagtgaa gaagtgcttc gcttagactg gaagttggaa   420
 421 tctgtggtga aaaaatattc ttttgcagta gaggctaaag gtttggagta tgttgcaaca   480
 481 gtggtaggaa gcattgatgg attatccgat tgttactgta taggcaaagg tcgtggagtg   540
 541 tgtagctcac aacctatcta ctttgaggta aagaagggag ataataaggt aacggcattt   600
 601 ttcaccgctt tcaaacaagt aaaggaaatg acaatgccga cgcgaatgtc aacatcagag   660
 661 agagaaactt ctagtgagaa aggtgctata atattaatat tgaaatttat caaaacagat   720
 721 aatacagttc aggaagcaac aattgatgtt actgaaataa taggtacact tgaaaatgct   780
 781 ggaacagggg aagatggaaa gccaacccca ccaccggaga ttgagttacc gcctgatgat   840
 841 aagattgagg ttgataagcc ggaaacacca ccgaatcctg atggaggtgg aggaatgggc   900
 901 ggcaatgttg atggatgggg acccgaagat aatgttgagt tacccgtgaa ttga   954
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu