LOADING...
   ZP_02065187.1;SP1225B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02065187.1    SP1225B            JCSG 419052 PDB Deposition 14-JAN-29              PDB id: 4onz

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02065187.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides ovatus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF04041; DUF377;
DR PDB; 4ONZ; Identical; 26-FEB-14; PUTATIVE GLYCOSIDE HYDROLASE;
DR PDB; 3TAW; Highly similar; 24-AUG-11; HYPOTHETICAL GLYCOSIDE HYDROLASE;
DR PDB; 3R67; Highly similar; 13-APR-11; PUTATIVE GLYCOSIDASE;
DR PDB; 3QC2; Highly similar; 09-FEB-11; GLYCOSYL HYDROLASE;
DR FFAS; 408109; Fold and function assignment.
DR TVPC; ZP_02065187.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02065187.1; Ortholog view popup.
DR TPM; ZP_02065187.1; Target PDB monitor.
DR FSS; ZP_02065187.1; Target function coverage.
PROPERTY Residues: 381 aa
Molecule Weight: 42767.7 Dalton
Isoelectric Point: 8.66
Extinction Coefficient: 66810
Gravy Index: -.47
Number of Met residues: 7
Percentage of Met residues: 1.84 %
Number of Cys residues: 8
Percentage of Cys residues: 2.10 %
SEQUENCE  amino acids 381 aa
>ZP_02065187.1  gi|160884184|ref|ZP_02065187.1| hypothetical protein BACOVA_02161 [Bacteroides ovatus ATCC 8483]
MKLKLIIGIVGILSACGFTNAPSLDTNQEKQDNNWVIGPFLRPEGVNPVISPQPTEFYCP
MRKQQVKWEESDTFNPAATVKDGKIVVLYRAEDNSAQGIGKRTSRVGYAESKDGIEMKRL
DNPVLFPAEDNFKDQDWPGGCEDPRVAMTEDGLYVMLYTAWNRKKARLAVATSRDLKNWT
KHGLAFDKAYNGRFNNLFCKSGSILTKLKGNQLVIDKVNGKYFMYWGEHAIYAATSDNLI
DWYPVLDEKNELMKIIQPRKGHFDSLLTECGPPAIRTKHGIVLVYNGKNSGKTGDANYPG
NAYCAGQLLLDGNDPYKVLDRLDKPFFAPEAPFEKSGQYKDGTVFIEGLVYHKKKLYLYY
GCADSQVAVAVCDDVKKLKTK

CDS  cDNA 1146 bp
   1 atgaaactga aacttatcat tggcatagtt ggtatattat ctgcatgtgg atttaccaat    60
  61 gcgccttctt tagatactaa tcaggagaaa caggataata attgggtgat cgggccattc   120
 121 ttgcgtcctg aaggagttaa tcctgtcata tcaccgcagc ctacagagtt ttattgcccg   180
 181 atgcgtaagc agcaagttaa gtgggaggaa agtgacactt ttaaccctgc tgctactgta   240
 241 aaagatggga agattgtcgt gctttatcgt gcagaagata attcggccca aggtataggt   300
 301 aaaagaacct cacgtgttgg ttatgctgaa agcaaggatg ggattgagat gaaaaggctt   360
 361 gataatcctg ttctttttcc tgctgaagat aattttaaag atcaagattg gccgggtggt   420
 421 tgtgaagatc ctcgtgtggc tatgaccgaa gacggactgt atgtgatgct ctacacagca   480
 481 tggaatcgga aaaaagcacg ccttgcagta gctacttccc gagacctgaa gaactggaca   540
 541 aaacacgggc ttgcctttga taaagcctat aatggtcgat ttaataacct tttctgtaaa   600
 601 tcggggtcta ttttaacaaa attgaaagga aatcaattgg tcatagacaa agttaatggc   660
 661 aagtatttca tgtattgggg agaacatgct atatatgctg ctacttctga taacctgatt   720
 721 gactggtatc cggttttgga tgagaagaat gaactgatga aaatcataca acctcgtaaa   780
 781 ggacattttg atagtttgtt gacagaatgt ggccctccgg ctattcgtac taagcatggc   840
 841 attgttctcg tgtataatgg taagaatagc ggtaaaactg gagatgctaa ctatcctggc   900
 901 aatgcttatt gtgccggaca gcttttattg gatggtaacg atccctataa agtattagac   960
 961 cgtttggata agcctttctt tgctcccgaa gctccttttg agaagagcgg acagtacaag  1020
1021 gacggaacag tatttatcga gggacttgtt tatcacaaga agaaactata cctctattat  1080
1081 ggttgtgcgg attcacaggt ggcggtagcg gtatgtgatg atgtgaagaa attgaaaaca  1140
1141 aaatag  1146
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu