LOADING...
   ZP_02064383.1;SP16867A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02064383.1    SP16867A            JCSG 420002 PDB Deposition 14-APR-04              PDB id: 4q1v

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02064383.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides ovatus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00930; DPPIV_N;
DR Pfam; PF00326; Peptidase_S9;
DR PDB; 4Q1V; Identical; 07-MAY-14; PUTATIVE DIPEPTIDYL AMINOPEPTIDASE IV;
DR PDB; 2D5L; Highly similar; 19-SEP-06; DIPEPTIDYL AMINOPEPTIDASE IV, PUTATIVE;
DR PDB; 2EEP; Highly similar; 19-FEB-08; DIPEPTIDYL AMINOPEPTIDASE IV, PUTATIVE;
DR PDB; 2DCM; Highly similar; 19-SEP-06; DIPEPTIDYL AMINOPEPTIDASE IV, PUTATIVE;
DR PDB; 2Z3W; Highly similar; 19-FEB-08; DIPEPTIDYL AMINOPEPTIDASE IV;
DR PDB; 2Z3Z; Highly similar; 19-FEB-08; DIPEPTIDYL AMINOPEPTIDASE IV;
DR PDB; 2ECF; Highly similar; 26-FEB-08; DIPEPTIDYL PEPTIDASE IV;
DR FFAS; 408222; Fold and function assignment.
DR TVPC; ZP_02064383.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02064383.1; Ortholog view popup.
DR TPM; ZP_02064383.1; Target PDB monitor.
DR FSS; ZP_02064383.1; Target function coverage.
PROPERTY Residues: 732 aa
Molecule Weight: 82698.54 Dalton
Isoelectric Point: 6.4
Extinction Coefficient: 126060
Gravy Index: -.48
Number of Met residues: 20
Percentage of Met residues: 2.73 %
Number of Cys residues: 10
Percentage of Cys residues: 1.37 %
SEQUENCE  amino acids 732 aa
>ZP_02064383.1  gi|160883380|ref|ZP_02064383.1| hypothetical protein BACOVA_01349 [Bacteroides ovatus ATCC 8483]
MSKIGKRAILLLLALPIGFNVMAQETKKPTLEELIPGGESYLYAENLYGLQWWGDECIKP
GVDTLYSIQPKTGKETMVITREQINKVLEENKAGKLSHLYSVRFPWTDKAQMLFTIAGKF
IVYNFKNNQVVSTFKPKDGANNEDYCAASGNVAYTIDNNLYVNEKAVTNEPEGIVCGQTV
HRNEFGINKGTFWSPKGNLLAFYRMDESMVTQYPLVDITARVGEVNNVRYPMAGMTSHQV
KVGIYNPATGKSIYLNAGDPTDRYFTNISWAPDEKSLYLIEVNRDQNHAKLCQYNAETGE
PMGVLYEEMHPKYVEPQNPIVFLPWDPTKFIYQSQRDGYNHLYLFETNAANMKGETYNSA
NGGSYFQAGKVKQLTKGNWLVSEILGFNTKRKEVIFTAVEGLRSGHFAVNVSNGKISQPF
ENCKESEHSGTLSASGTYLIDRYSTKDQPRVINLVDTKNFKETANLLTAENPYDGYQMPS
IETGTIKAADGTTDLHYRLMKPANFDPAKKYPVIVYVYGGPHAQCVTGGWQNGARGWDTY
MASKGYIMFTIDNRGSSNRGLTFENATFRRLGIEEGKDQVKGVEFLKSLPYVDSERIGVH
GWSFGGHMTTALMLRYPEIFKVGVAGGPVIDWGYYEIMYGERYMDTPESNPEGYKECNLK
NLADQLKGHLLIIHDDHDDTCVPQHTLSFMKACVDARTYPDLFIYPCHKHNVAGRDRVHL
HEKITRYFEQNL

CDS  cDNA 2199 bp
   1 atgagtaaaa ttggaaaaag agccattctg ttattgttgg cactaccaat cggattcaat    60
  61 gttatggcac aagaaaccaa aaaaccgacg ctggaagaac tgattccggg cggcgagagt   120
 121 tacctctatg cagaaaacct gtacgggctg caatggtggg gcgacgaatg tatcaagcca   180
 181 ggagtagata ccctttattc aattcaaccc aaaaccggga aagaaacaat ggttatcact   240
 241 cgcgagcaaa tcaacaaagt gcttgaagaa aacaaggcag gaaaattatc acacctgtat   300
 301 tccgtccgtt ttccatggac agacaaggca caaatgctat tcacgatagc aggaaagttc   360
 361 attgtatata atttcaagaa caatcaggtt gtcagcactt tcaaaccaaa ggacggggca   420
 421 aataatgaag actattgcgc agccagtgga aatgtggctt acacgataga taacaatcta   480
 481 tatgtgaatg agaaagcagt aaccaatgaa cccgaaggca tcgtttgcgg acaaacagtg   540
 541 caccgcaatg aattcggtat caacaaagga actttctgga gtccgaaagg caacctgctc   600
 601 gctttctacc gtatggatga aagcatggtg acacaatacc cgcttgtaga catcactgca   660
 661 cgtgtaggcg aagtaaataa cgtacgctat ccgatggcag gaatgacgag ccatcaggta   720
 721 aaagtaggca tttacaaccc tgctaccggt aaaagcattt atctgaatgc aggcgatccg   780
 781 acagaccgtt atttcactaa catcagctgg gcaccggatg aaaagagcct ctacctgatc   840
 841 gaagtaaacc gcgaccagaa tcatgccaaa ctctgccagt acaacgcaga gacaggagaa   900
 901 cccatgggag ttctctatga agaaatgcac cctaaatacg ttgaaccgca aaaccccatc   960
 961 gtatttttgc cgtgggaccc taccaagttc atctatcaaa gtcagcgtga cggctacaat  1020
1021 cacctttatc tctttgagac aaatgcagca aacatgaaag gtgaaaccta taatagtgcc  1080
1081 aacggcggta gttatttcca ggccggtaaa gtaaaacagc taaccaaagg caactggctg  1140
1141 gtcagcgaaa tcctaggatt caacacaaag cgtaaagagg tcatcttcac tgccgtagaa  1200
1201 ggcttgagaa gcggccattt tgcagtaaac gtaagtaatg gaaagataag ccagccgttt  1260
1261 gagaactgca aggaaagcga acatagcgga acacttagcg cctctggcac ataccttatc  1320
1321 gaccgttatt ccaccaaaga ccaaccccgc gtcatcaacc tggtagacac caaaaacttc  1380
1381 aaagaaacag ccaacttgct gacagccgaa aatccttacg acggatacca gatgccaagc  1440
1441 atcgaaaccg gaacaatcaa agcggcagac ggcactaccg acctgcatta ccgcctgatg  1500
1501 aagccggcaa acttcgatcc ggctaagaaa tatcccgtaa tcgtatatgt ctacggaggc  1560
1561 cctcacgcgc aatgcgtcac cggaggatgg cagaacggcg cacgcggatg ggacacatac  1620
1621 atggcaagca aaggctatat catgttcacc atcgacaatc gcggtagcag caaccgcgga  1680
1681 ctaacatttg aaaatgccac cttccgccgt ctcggcatcg aagaaggcaa agaccaggta  1740
1741 aaaggcgttg aattcctgaa atccctcccc tacgtagaca gcgagcgcat cggcgtacac  1800
1801 ggatggagtt ttggaggtca catgactacc gccctgatgc tccgttaccc ggagatattc  1860
1861 aaagtaggcg ttgccggagg tccggtaatc gactggggtt actatgaaat aatgtacggc  1920
1921 gaacgctata tggacacacc ggaaagcaat ccggaaggct acaaagaatg taatctgaaa  1980
1981 aaccttgccg accaactgaa aggtcaccta ttgattattc acgacgacca cgacgacacc  2040
2041 tgcgtgccac aacacaccct gtcgttcatg aaagcctgtg tagatgcccg cacttatccc  2100
2101 gacctgttta tctacccgtg ccacaagcac aacgtagcag gacgcgaccg tgtacatctg  2160
2161 catgagaaaa tcacccggta ctttgagcag aacttataa  2199
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu