LOADING...
   ZP_02064002.1;SP16639D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02064002.1    SP16639D            JCSG 419407 PDB Deposition 14-FEB-19              PDB id: 2ml5

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02064002.1
DESCRIPTIONNMR structure of a cystatin-like protein,divergent member of PF14254, DUF4348
ORGANISMBacteroides ovatus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2ML5; Identical; 19-MAR-14; UNCHARACTERIZED PROTEIN;
DR PDB; 4R4K; Identical; 01-OCT-14; UNCHARACTERIZED PROTEIN;
DR PDB; 2ML6; Highly similar; 12-MAR-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 408620; Fold and function assignment.
DR TVPC; ZP_02064002.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02064002.1; Ortholog view popup.
DR TPM; ZP_02064002.1; Target PDB monitor.
DR FSS; ZP_02064002.1; Target function coverage.
PROPERTY Residues: 186 aa
Molecule Weight: 21263.01 Dalton
Isoelectric Point: 4.88
Extinction Coefficient: 26930
Gravy Index: -.43
Number of Met residues: 3
Percentage of Met residues: 1.61 %
Number of Cys residues: 4
Percentage of Cys residues: 2.15 %
SEQUENCE  amino acids 186 aa
>ZP_02064002.1  gi|160882999|ref|ZP_02064002.1| hypothetical protein BACOVA_00961 [Bacteroides ovatus ATCC 8483]
MRAKKFVCCLLAMLLFAGVSFISCGNSSKAKADSELTTQDGEDFKSFLDKFTSSAAFQYT
RVKFPLKTPITLLADDGETEKTFPFTKEKWPLLDSETMKEERITQEEGGIYVSKFTLNEP
KHKIFEAGYEESEVDLRVEFELQADGKWYVVDCYTGWYGYDLPIGELKQTIQNVKEENAA
FKEIHP

CDS  cDNA 561 bp
   1 atgagagcta aaaagtttgt atgctgcttg ctggctatgc tgctgttcgc cggtgtttcg    60
  61 tttatctcct gcggtaatag ttccaaggca aaagccgata gtgaactgac tacgcaagac   120
 121 ggtgaagatt tcaaatcatt tctggataaa tttacttcca gtgcagcctt ccagtatact   180
 181 cgtgtcaagt tcccattaaa gaccccgatt actttattgg cagatgacgg cgaaaccgaa   240
 241 aagacgttcc ctttcactaa ggaaaaatgg ccgttgctgg atagcgaaac catgaaggaa   300
 301 gaacgtatca cccaggaaga agggggaatc tatgtctcca agtttacgct gaatgaaccg   360
 361 aaacacaaaa tctttgaagc gggctatgaa gagtccgaag tggatttgcg tgtcgagttc   420
 421 gaattgcagg ctgacgggaa atggtatgtg gtggattgct atacaggctg gtatggatat   480
 481 gacttgccga ttggggagtt aaaacagact attcagaatg tgaaagaaga aaatgccgca   540
 541 ttcaaagaaa tacatccgta g   561
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu