LOADING...
   ZP_02063955.1;SP8979C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02063955.1    SP8979C            JCSG 416889 PDB Deposition 13-JUL-01              PDB id: 4lhs

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02063955.1
DESCRIPTIONPutative GDSL-like lipase, two domains protein, N-terminus is GxDLY domain (PF14607 family), C-terminus is lipase GDSL 3 (PF14606
family)
ORGANISMBacteroides ovatus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4LHS; Identical; 07-AUG-13; UNCHARACTERIZED PROTEIN;
DR FFAS; 408194; Fold and function assignment.
DR TVPC; ZP_02063955.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02063955.1; Ortholog view popup.
DR TPM; ZP_02063955.1; Target PDB monitor.
DR FSS; ZP_02063955.1; Target function coverage.
PROPERTY Residues: 365 aa
Molecule Weight: 40886.11 Dalton
Isoelectric Point: 9.03
Extinction Coefficient: 34380
Gravy Index: -.33
Number of Met residues: 10
Percentage of Met residues: 2.74 %
Number of Cys residues: 3
Percentage of Cys residues: 0.82 %
SEQUENCE  amino acids 365 aa
>ZP_02063955.1  gi|160882952|ref|ZP_02063955.1| hypothetical protein BACOVA_00914 [Bacteroides ovatus ATCC 8483]
MKNLIRNVWVCLGLMVLPFTASGQQKDNITYVPAQELLLVGKATTEGEYFHRVDTAKYRT
MPPTVKKLFTNSAGLAISFTTNSPVIKAKWMVPDNYQLPNLTRVAQKGLDLYIKRDGKWQ
FAGVGIPGGVTTEKVLVDNMGTEEKECLLYLPLYDELKSLEIGVSSDAHIRKGENPFKEK
IVVYGSSILQGASASRPGMAYPARLSRSSGYNFINLGLSGNGKMEKEVAEMLADIDADAF
ILDCIPNPSPKEITDRTVDFVMTLRQKHPDTPIIVIQTLIRETGNFNQKARENVKRQNEA
IAEQVEVLRKKNVKNLYFIKEDQFLGTDHEGTVDGTHPNDLGFDRMLKKYKPAISKILKI
KFKAE

CDS  cDNA 1098 bp
   1 atgaaaaact taatacgaaa tgtctgggtt tgcttggggc tgatggtgct tcccttcaca    60
  61 gcctccggac aacaaaagga taacattacc tatgtgccgg ctcaagagct tttactggta   120
 121 ggcaaagcaa ctaccgaagg cgaatacttc catcgggtag atacagccaa gtatcgtaca   180
 181 atgcctccca cagtgaagaa actattcaca aactctgccg gtctggctat ctcttttaca   240
 241 acgaatagcc ccgtcataaa agccaaatgg atggttcctg ataattacca gttacccaat   300
 301 ctgaccagag ttgctcagaa aggtctggat ttatatatca aacgggatgg aaaatggcaa   360
 361 tttgccggag tagggatacc gggtggtgtg actacggaaa aagtgcttgt tgataatatg   420
 421 ggtacggaag agaaagaatg tttgttatat ctgcctttat atgatgaact gaaaagtctg   480
 481 gaaataggtg tttcttctga tgcacacata cgtaaaggag aaaatccgtt caaagaaaag   540
 541 atagtggtat acgggtccag tattttgcag ggagcatctg ccagtcgtcc cgggatggct   600
 601 tatccggctc gtttgtcccg tagcagcgga tataatttta tcaatttagg attgagcgga   660
 661 aacggcaaga tggagaaaga agttgccgag atgttggcgg atattgatgc ggatgctttc   720
 721 attctcgatt gtattcctaa tccttctccc aaagagataa ccgaccggac tgttgatttt   780
 781 gtaatgacgt tgcgccagaa gcatccggat acgcctatta ttgtgataca gacattgata   840
 841 cgtgaaacag gtaatttcaa ccagaaagct cgtgagaatg taaaacgaca gaacgaggcc   900
 901 atcgctgaac aggtagaagt attgcgaaag aagaatgtca agaacctgta tttcataaaa   960
 961 gaagatcaat tcttgggaac agaccatgag gggactgtag atgggaccca tccgaatgac  1020
1021 ttgggattcg accgaatgtt gaagaaatat aaaccggcta tcagtaagat tctgaagatc  1080
1081 aaattcaagg ctgaataa  1098
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu