LOADING...
   ZP_02063319.1;SP13221C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02063319.1    SP13221C            JCSG 416762 PDB Deposition 12-NOV-07              PDB id: 4hw6

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02063319.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides ovatus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF01833; TIG;
DR Pfam; PF01436; NHL;
DR PDB; 4HW6; Identical; 12-DEC-12; HYPOTHETICAL PROTEIN, IPT/TIG DOMAIN PROTEIN;
DR PDB; 3TC9; Highly similar; 21-SEP-11; HYPOTHETICAL HYDROLASE;
DR PDB; 3KYA; Highly similar; 22-DEC-09; PUTATIVE PHOSPHATASE;
DR FFAS; 408149; Fold and function assignment.
DR TVPC; ZP_02063319.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02063319.1; Ortholog view popup.
DR TPM; ZP_02063319.1; Target PDB monitor.
DR FSS; ZP_02063319.1; Target function coverage.
PROPERTY Residues: 465 aa
Molecule Weight: 52483.33 Dalton
Isoelectric Point: 5.79
Extinction Coefficient: 85720
Gravy Index: -.41
Number of Met residues: 9
Percentage of Met residues: 1.94 %
Number of Cys residues: 13
Percentage of Cys residues: 2.80 %
SEQUENCE  amino acids 465 aa
>ZP_02063319.1  gi|160882316|ref|ZP_02063319.1| hypothetical protein BACOVA_00264 [Bacteroides ovatus ATCC 8483]
MIQVTRRHVFSKALLQKTLFVAGLVLFSSCYKGSTLDVNQDSGTPFNPKEEIVVEKFLPT
EGRKGTRVVVYGRNFGNDVSKVKVTIGGYPAKVINVKGESLLCICPSKAYEGDVKVSVVG
DDEAELKSGVCEAKFDYQYNYVVTTFLGKLYENNTKWDVLAGPFDDCGAFDNIWRMMFDP
NSNYDDLYWVGQRDAFRHVDFVNQYVDIKTTNIGQCADVNFTLNGDMVVVDDQSSDTNTG
IYLFTRASGFTERLSLCNARGAKTCAVHPQNGKIYYTRYHHAMISSYDPATGTLTEEEVM
MDTKGSNFHIVWHPTGDWAYIIYNGKHCIYRVDYNRETGKLAVPYIVCGQHSSPGWVDGM
GTGARLWGPNQGIFVKNEAYAGEEDEYDFYFCDRDSHTVRVLTPEGRVTTYAGRGNSREW
GYVDGELRSQALFNHPTSIAYDMKRKCFYIGDCDNHRVRKIAPEE

CDS  cDNA 1398 bp
   1 atgatacagg ttacaagacg acatgtattt tctaaagcgt tgctgcagaa gacattattt    60
  61 gtggcgggct tagtcctttt ttcttcttgt tacaagggca gtaccttgga tgtaaatcag   120
 121 gattcgggta ctccgttcaa tcctaaagag gagattgtag tagagaagtt tctgcctacc   180
 181 gaggggcgta aagggactcg tgtagtggta tatggccgaa atttcggtaa cgacgtgagt   240
 241 aaagtaaaag ttacgattgg cggctatccc gccaaagtta tcaatgtaaa gggcgaatcg   300
 301 ttgctttgca tttgtccatc gaaagcttat gaaggagatg taaaagtctc tgttgttggt   360
 361 gatgacgagg ctgagctgaa gagcggtgtg tgtgaagcca agtttgatta ccaatataat   420
 421 tatgtggtaa ccaccttctt gggcaaactt tatgagaaca ataccaaatg ggatgtgctg   480
 481 gccggtccgt ttgacgattg tggtgcattt gacaacattt ggcgcatgat gttcgatcct   540
 541 aacagcaatt atgatgacct ctattgggtt ggtcagagag atgctttccg tcatgtggat   600
 601 ttcgtgaatc aatatgtaga tatcaaaact accaatattg ggcaatgcgc agatgtgaac   660
 661 tttacgctta atggcgatat ggtagtggtg gacgatcaaa gttcggatac aaataccggt   720
 721 atttatctgt ttacccgtgc cagtgggttt accgaacgtt tgtctctttg taatgctcgt   780
 781 ggagcaaaga cgtgtgccgt tcatccccaa aatggaaaaa tctattatac acgttatcac   840
 841 catgctatga tatcatctta cgatccggct acaggcacgt tgactgaaga ggaggtaatg   900
 901 atggatacta aaggctcaaa cttccacatc gtttggcatc ccacaggtga ctgggcttac   960
 961 atcatctaca atggcaaaca ttgcatctat cgtgtggatt ataatagaga aaccggaaaa  1020
1021 ttggctgttc cctatattgt atgcggacaa catagtagcc caggatgggt tgacggaatg  1080
1081 ggcacaggtg cacggttgtg ggggccaaac caaggtattt tcgtgaagaa tgaagcttat  1140
1141 gccggcgaag aggatgaata cgacttctac ttctgcgatc gtgatagcca tactgttcgt  1200
1201 gttctcacac ccgaaggtcg tgtgacaacc tacgctggtc gcggtaatag ccgtgaatgg  1260
1261 ggttatgtgg atggagaact tcgctctcaa gcactcttca atcatcccac cagtatcgct  1320
1321 tacgacatga aacgtaagtg tttttatatc ggtgactgcg acaaccatcg cgtacgcaaa  1380
1381 attgcgccgg aagaataa  1398
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu