LOADING...
   ZP_02043836.1;SP17439A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02043836.1    SP17439A            JCSG 419866 PDB Deposition 15-MAY-28              PDB id: 5bq3

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02043836.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMActinomyces odontolyticus atcc 17982
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4KVF; Highly similar; 05-JUN-13; RHAMNOSE ABC TRANSPORTER, PERIPLASMIC RHAMNOSE-BI PROTEIN;
DR PDB; 4WZZ; Highly similar; 17-DEC-14; PUTATIVE SUGAR ABC TRANSPORTER, SUBSTRATE-BINDING CHAIN: A;
DR PDB; 1TJY; Highly similar; 28-SEP-04; SUGAR TRANSPORT PROTEIN;
DR PDB; 1TM2; Highly similar; 28-SEP-04; SUGAR TRANSPORT PROTEIN;
DR PDB; 3T95; Highly similar; 07-DEC-11; AUTOINDUCER 2-BINDING PROTEIN LSRB;
DR PDB; 4PZ0; Highly similar; 09-APR-14; SUGAR ABC TRANSPORTER, SUGAR-BINDING PROTEIN;
DR PDB; 3EJW; Highly similar; 02-DEC-08; SMLSRB;
DR FFAS; 406568; Fold and function assignment.
DR TVPC; ZP_02043836.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02043836.1; Ortholog view popup.
DR TPM; ZP_02043836.1; Target PDB monitor.
DR FSS; ZP_02043836.1; Target function coverage.
PROPERTY Residues: 352 aa
Molecule Weight: 36499.67 Dalton
Isoelectric Point: 4.49
Extinction Coefficient: 22920
Gravy Index: -.06
Number of Met residues: 7
Percentage of Met residues: 1.99 %
Number of Cys residues: 3
Percentage of Cys residues: 0.85 %
SEQUENCE  amino acids 352 aa
>ZP_02043836.1  gi|154508194|ref|ZP_02043836.1| hypothetical protein ACTODO_00688 [Actinomyces odontolyticus ATCC 17
MKKGVAALGALSLTSALLMSACGGGTSTQGSESSSGGDASGSYDVSSQSITFIPKQLNNP
FSDVMLGGGKNAAGEIGFAEVNVVGPLEASSSSQVSFINSEVQAGTNVLVIAANDPDAVC
PALQDARKAGTKVVTFDSDSAADCRDLFINQVESKQVAITMLDMVSDQIGGSGKVAILSA
TANAANQNAWIKFMEDEIASNDKYKGIEIVAKVYGDDDDTKSFQEAQGLLQAHPDLNAIV
SPTTVGIAATARYLSTSDYKGKVFLTGLGLPNEMRSFVKDGTVKEFALWDPAQLGYVAAY
AGAALDSGAIKGEVGEKFTAGNLGERTIGENKTVVVGDPVRFNADNIDKYDF

CDS  cDNA 1059 bp
   1 atgaagaaag gtgtggccgc acttggcgca ctctcgctga cctcggccct cctgatgtcc    60
  61 gcctgtggcg gtggaacgtc gacgcagggc agtgagtcca gttccggcgg cgatgcctcc   120
 121 ggttcgtacg atgtttcgtc ccagtcgatt acgtttatcc ccaagcagct gaacaacccg   180
 181 ttctccgacg tcatgctcgg cggcggcaag aacgctgcgg gcgagatcgg cttcgccgag   240
 241 gtcaacgtcg tcggtccgct cgaggcgtcc tcctcctcgc aggtctcctt catcaactcc   300
 301 gaggtgcagg caggcacgaa cgtcctcgtg atcgccgcga atgaccccga tgccgtatgc   360
 361 cctgcgcttc aggatgcgcg caaggccggt acaaaggtcg tcaccttcga ctccgacagc   420
 421 gcggccgatt gccgagacct gttcatcaac caggttgaat ccaagcaggt tgcaatcacc   480
 481 atgctcgaca tggtctctga ccagatcggc ggttccggta aggtagccat cctctctgcg   540
 541 acggcgaacg ccgccaacca gaacgcgtgg atcaagttca tggaggatga gatcgcctcg   600
 601 aacgacaagt acaagggcat tgagatcgtc gcgaaggtct atggcgatga cgatgacacg   660
 661 aagtcgttcc aggaggcgca gggcctgctc caggctcacc ccgaccttaa tgcgatcgtc   720
 721 tccccgacca ccgtcggtat cgccgccacc gctcgctacc tgtcgacctc tgactacaag   780
 781 ggcaaggtct tcctgaccgg cctgggtctg ccgaacgaaa tgcgttcctt cgtgaaggat   840
 841 ggaaccgtca aggagtttgc cctgtgggat cccgcccagc taggatacgt ggccgcatac   900
 901 gcgggtgcag cgctcgatag tggtgcgatc aagggcgagg taggggagaa gttcactgcc   960
 961 ggaaacctcg gtgaacgcac gatcggcgag aacaagaccg tcgtcgtcgg tgaccccgtg  1020
1021 cgcttcaacg cggacaacat cgacaagtac gacttctga  1059
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu