LOADING...
   ZP_02043769.1;SP17443B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02043769.1    SP17443B            JCSG 418621 PDB Deposition 13-SEP-03              PDB id: 4mjg

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02043769.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMActinomyces odontolyticus atcc 17982
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4MJG; Identical; 16-OCT-13; HYPOTHETICAL PROTEIN;
DR FFAS; 406593; Fold and function assignment.
DR TVPC; ZP_02043769.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02043769.1; Ortholog view popup.
DR TPM; ZP_02043769.1; Target PDB monitor.
DR FSS; ZP_02043769.1; Target function coverage.
PROPERTY Residues: 226 aa
Molecule Weight: 24305.23 Dalton
Isoelectric Point: 4.99
Extinction Coefficient: 23950
Gravy Index: -.14
Number of Met residues: 5
Percentage of Met residues: 2.21 %
Number of Cys residues: 4
Percentage of Cys residues: 1.77 %
SEQUENCE  amino acids 226 aa
>ZP_02043769.1  gi|154508127|ref|ZP_02043769.1| hypothetical protein ACTODO_00621 [Actinomyces odontolyticus ATCC 17
MNMTKKWTPVRVGAWCVVVVAVLGGCHAAKSRDAEFVPFPERVSIEEYISRQLPEISSVA
VPVAAETGGELTVMGLPYVQVCGTGDTQGYRVVGYTTVAPSMSFERLEKLVTENKPDWAV
AVQVDKQIDRDATRGIQLIDNYGGLVEFKFSEDSIAVRSRSACLPTNKPLDDPGQFVLPS
VEEAFPGMHVTISDNTNPDLHPVPTLTTGAHVTPQSGTQSGTQSGS

CDS  cDNA 681 bp
   1 atgaacatga caaagaaatg gaccccagta cgcgtgggtg cgtggtgcgt cgtggtggtg    60
  61 gccgtgttgg gtgggtgtca tgcagcaaag tcgcgcgatg ctgagttcgt tccctttcct   120
 121 gagcgtgtga gcattgaaga gtacataagc cgtcagctgc cggagatatc gagtgtggct   180
 181 gtgccggtgg ctgccgagac cggtggtgag ctgacggtga tgggcctgcc gtatgtgcaa   240
 241 gtgtgtggca ctggtgatac ccaggggtat cgggtggttg gctacaccac ggtggctccg   300
 301 tcgatgtcct ttgagcgact cgagaaactg gtgacagaaa acaagcccga ttgggcggtg   360
 361 gccgtgcagg ttgacaagca aatcgatagg gatgctactc ggggtattca gctgatcgac   420
 421 aactatggcg gccttgtcga gttcaagttt tcggaggact ctatcgccgt gaggtcgcgc   480
 481 tccgcgtgtt tgccgacgaa taagcccctg gatgatcccg gtcagttcgt tctgccctcg   540
 541 gtggaggagg cgttcccggg catgcacgtg acgatcagcg acaacacgaa cccggacctg   600
 601 cacccggtcc ccacactgac cacgggcgct cacgtcaccc cacaatccgg tacccagagc   660
 661 ggcacccagt cgggctcgta a   681
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu