LOADING...
   ZP_02042476.1;SP17945A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02042476.1    SP17945A            JCSG 417406 PDB Deposition 13-AUG-27              PDB id: 2mct

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02042476.1
DESCRIPTIONNMR structure of the protein ZP_02042476.1
ORGANISMRuminococcus gnavus atcc 29149
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2MCT; Identical; 13-NOV-13; UNCHARACTERIZED PROTEIN;
DR FFAS; 413549; Fold and function assignment.
DR TVPC; ZP_02042476.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02042476.1; Ortholog view popup.
DR TPM; ZP_02042476.1; Target PDB monitor.
DR FSS; ZP_02042476.1; Target function coverage.
PROPERTY Residues: 124 aa
Molecule Weight: 14203.32 Dalton
Isoelectric Point: 4.37
Extinction Coefficient: 13410
Gravy Index: -.35
Number of Met residues: 4
Percentage of Met residues: 3.23 %
Number of Cys residues: 6
Percentage of Cys residues: 4.84 %
SEQUENCE  amino acids 124 aa
>ZP_02042476.1  gi|154505738|ref|ZP_02042476.1| hypothetical protein RUMGNA_03278 [Ruminococcus gnavus ATCC 29149]
MKKLFVVLGICLCLCFGCAEDNRSPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSE
IATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNF
EDMI

CDS  cDNA 375 bp
   1 atgaagaagt tatttgttgt attgggaatt tgtttatgtc tgtgttttgg atgtgcagag    60
  61 gataatcgct caccgattct tccaaaagcg gagaatgttg actctatttg tattgatttc   120
 121 acgaacagta ttcaaaaaat atatgatgat tcagaaagca tccagaagat attatcagag   180
 181 attgcgactg gaaaacgaac ggagaaacaa tcgattcaag attatccgtc agcagaagaa   240
 241 tatggaacga taaatattga aaataatggt ggaatgacaa ccatgtttta ttatgaagag   300
 301 aacgggaaat attatattga atgtccatat aaaggaattt atgaaataga aaacaatttt   360
 361 gaagatatga tttaa   375
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu