LOADING...
   ZP_02041626.1;SP17834A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02041626.1    SP17834A            JCSG 417401 PDB Deposition 14-MAY-05              PDB id: 4qan

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02041626.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMRuminococcus gnavus atcc 29149
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4QAN; Identical; 23-JUL-14; HYPOTHETICAL PROTEIN;
DR FFAS; 413542; Fold and function assignment.
DR TVPC; ZP_02041626.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02041626.1; Ortholog view popup.
DR TPM; ZP_02041626.1; Target PDB monitor.
DR FSS; ZP_02041626.1; Target function coverage.
PROPERTY Residues: 420 aa
Molecule Weight: 48170.42 Dalton
Isoelectric Point: 4.74
Extinction Coefficient: 54780
Gravy Index: -.46
Number of Met residues: 13
Percentage of Met residues: 3.10 %
Number of Cys residues: 6
Percentage of Cys residues: 1.43 %
SEQUENCE  amino acids 420 aa
>ZP_02041626.1  gi|154504888|ref|ZP_02041626.1| hypothetical protein RUMGNA_02398 [Ruminococcus gnavus ATCC 29149]
MKKMEKKWPFVFNGIVIFCLILLILGMRWQAKKEESEVLNVTESLQKESEITSFSEEEEA
VLYMLSALKKNDLDMALRGCAIDETALQINFVKTAEELPGMQLIDLPAPTSDYSYYFPLT
SAEMTKAYIEQFEELSTEIPEIETLEVLEIAEKKEKEREEQLAECLAAQEVSELEIYVKC
GEQSYRLGFTAVQYEKNWKIHSLKEGLLYETDIPACVQMEEMREAKKTYVLPNQLTGANY
FQAMPISEKTPQRAVEQFIYAIEKGDLTRALAFATTESSQDTSPELLKKQGEYAKELKTM
LYGFLGTEDARLYGKSEEQLNKLRGKLNPEYMVYLDLIKVIPIETEENTETVKQYAGLYS
YNGKNYLTGYTLCRQEDGWQIQSLSAPALSLESGEVMRLSKEESRKTSEQSVLKAEKNER

CDS  cDNA 1263 bp
   1 atgaaaaaaa tggaaaaaaa atggcctttt gttttcaatg gcatcgtcat attctgtttg    60
  61 atcctgctga ttctgggaat gcgctggcag gcgaaaaagg aagagtcaga agtattaaat   120
 121 gttacagaaa gtcttcagaa agaaagtgag atcacttctt tttcagagga agaagaggca   180
 181 gtgttatata tgttgagtgc cttgaaaaag aacgaccttg atatggcact tagaggatgt   240
 241 gcaattgatg agacagctct gcagatcaat tttgtaaaga cagcagagga actcccgggg   300
 301 atgcagctta tagatctgcc ggctccaaca tcagattatt cgtattattt tccgcttaca   360
 361 tcggcagaaa tgaccaaagc atatattgag cagtttgaag aattgtcgac agaaattccg   420
 421 gagatagaga cgttggaagt gctggagatt gcagagaaaa aggagaaaga acgagaagaa   480
 481 cagctggcag agtgtctggc ggctcaggaa gtcagtgaac tggaaattta tgtgaaatgt   540
 541 ggggaacaga gttacagact ggggtttacg gcagtacaat atgagaaaaa ctggaaaatc   600
 601 cattcactaa aagaagggct tctctatgaa acggatatac ctgcctgtgt gcagatggaa   660
 661 gagatgcgcg aggcaaaaaa aacgtatgtg cttccaaatc agctgacagg tgccaattat   720
 721 tttcaggcga tgccaatttc agaaaaaaca ccgcagcggg cagtggagca gtttatttat   780
 781 gcaattgaaa agggggatct gacaagagcg ctggcgtttg caacaacaga atccagtcag   840
 841 gatacatccc cggaactgtt gaaaaaacag ggagaatatg caaaagagtt aaaaacaatg   900
 901 ctgtatggat ttttaggtac ggaagatgca agattgtacg ggaaaagcga agaacagctg   960
 961 aataagctgc gcggaaagtt gaacccggaa tatatggtat atctggattt gatcaaagtg  1020
1021 attccaatag aaactgagga aaatacagag acagtcaaac aatatgccgg attatattca  1080
1081 tacaacggga aaaattatct gacaggctat accctttgca gacaggagga tggatggcag  1140
1141 attcagtcat tgagtgcacc ggcactgtct cttgaatccg gagaagtgat gcggctgtca  1200
1201 aaagaagaaa gccgaaaaac atccgagcaa agtgtgttaa aggcagaaaa aaatgaaaga  1260
1261 tag  1263
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu