LOADING...
   ZP_02041089.1;SP17944A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02041089.1    SP17944A            JCSG 417405 PDB Deposition 13-AUG-21              PDB id: 2mc8, 4hyz

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02041089.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMRuminococcus gnavus atcc 29149
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4HYZ; Identical; 09-JAN-13; UNCHARACTERIZED PROTEIN;
DR PDB; 2MC8; Identical; 23-OCT-13; UNCHARACTERIZED PROTEIN;
DR FFAS; 413548; Fold and function assignment.
DR TVPC; ZP_02041089.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02041089.1; Ortholog view popup.
DR TPM; ZP_02041089.1; Target PDB monitor.
DR FSS; ZP_02041089.1; Target function coverage.
PROPERTY Residues: 149 aa
Molecule Weight: 16810.34 Dalton
Isoelectric Point: 5.04
Extinction Coefficient: 17420
Gravy Index: -.48
Number of Met residues: 7
Percentage of Met residues: 4.70 %
Number of Cys residues: 2
Percentage of Cys residues: 1.34 %
SEQUENCE  amino acids 149 aa
>ZP_02041089.1  gi|154504351|ref|ZP_02041089.1| hypothetical protein RUMGNA_01855 [Ruminococcus gnavus ATCC 29149]
MKKNMKKLAVGFGVFVMAVGSLMGCSSLGSGGNEQGEILKELPEGFDKETVRKQAMEDIE
IAQSKDYESWKSRFTKDLQSSLTEESYDSYLKILEKQGEFKEFGKCTYLGQIKDNKKYGG
VIIVVKYEEGNVNYSLAYDEDMNLVSFTM

CDS  cDNA 450 bp
   1 atgaaaaaga atatgaaaaa actggcagtg ggattcggcg ttttcgtgat ggcagtggga    60
  61 agtctgatgg gatgcagctc tctgggaagc ggaggaaatg aacaaggaga gatcctgaaa   120
 121 gaactgccgg aagggtttga caaggagaca gtaagaaagc aggcaatgga agatattgag   180
 181 atcgcgcagt ctaaagatta tgagagctgg aaaagcaggt ttaccaagga tctgcagagc   240
 241 agtctgacag aagaatcgta cgattcctat ttgaaaatcc tggagaaaca gggagaattc   300
 301 aaagagtttg gaaaatgtac gtatttaggg cagataaaag ataataaaaa gtacggcgga   360
 361 gtcattattg tggtaaaata tgaagaaggc aatgtcaatt acagtcttgc gtatgacgag   420
 421 gatatgaatc tggtcagctt tacgatgtaa   450
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu