LOADING...
   ZP_02040096.1;SP17422C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02040096.1    SP17422C            JCSG 416853 PDB Deposition 12-DEC-07              PDB id: 4ib2

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02040096.1
DESCRIPTIONPutative lipoprotein, putative methionine - bindning, NLPA lipoprotein, PF03180 family
ORGANISMRuminococcus gnavus atcc 29149
COMMENTThis hypothetical protein is from an anaerobic, gram-positive gut bacteria,
Ruminococcus gnavus. It is remotely homologous to ABC transporter family.
Top homology in PDB includes membrane associated-lipoprotein 9 from
Staphylococcus aureus (PDB 1P99).
It is possibly a methionine binding lipoprotein.
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF03180; Lipoprotein_9;
DR PDB; 4IB2; Identical; 16-JAN-13; PUTATIVE LIPOPROTEIN;
DR PDB; 4K3F; Highly similar; 24-APR-13; PROBABLE TONB-DEPENDENT RECEPTOR;
DR PDB; 4QHQ; Highly similar; 18-JUN-14; LIPOPROTEIN;
DR PDB; 1XS5; Highly similar; 23-NOV-04; MEMBRANE LIPOPROTEIN TPN32;
DR PDB; 4EF1; Highly similar; 25-APR-12; PHEROMONE COB1/LIPOPROTEIN, YAEC FAMILY;
DR PDB; 4EF2; Highly similar; 25-APR-12; PHEROMONE COB1/LIPOPROTEIN, YAEC FAMILY;
DR PDB; 4GOT; Highly similar; 10-OCT-12; METHIONINE-BINDING LIPOPROTEIN METQ;
DR PDB; 4YAH; Highly similar; 08-APR-15; D-METHIONINE-BINDING LIPOPROTEIN METQ;
DR FFAS; 413499; Fold and function assignment.
DR TVPC; ZP_02040096.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02040096.1; Ortholog view popup.
DR TPM; ZP_02040096.1; Target PDB monitor.
DR FSS; ZP_02040096.1; Target function coverage.
PROPERTY Residues: 278 aa
Molecule Weight: 30287.2 Dalton
Isoelectric Point: 4.53
Extinction Coefficient: 20860
Gravy Index: -.31
Number of Met residues: 1
Percentage of Met residues: 0.36 %
Number of Cys residues: 1
Percentage of Cys residues: 0.36 %
SEQUENCE  amino acids 278 aa
>ZP_02040096.1  gi|154503036|ref|ZP_02040096.1| hypothetical protein RUMGNA_00858 [Ruminococcus gnavus ATCC 29149]
MKKVTAIILTGILTLGVLTGCQSNSKAEEKGSSEDAKTIKVAASATPHAEILEQAKSILK
KEGYQLEVTVFDDYVQPNEVVESGEFDANYFQHVPYLESFNEEKGTHLVDAGDIHYEPFG
IYPGTKKSLDEISEGDKIAVPNDTTNEARALLLLQDNGIITLKDGAGLNATVNDIEENPY
NVEIVELEAAQVARVTGETAYVVLNGNYALEAGYSVAKDALAYEKSDSEAAKTYVNIIAV
KEGNEKEEKIQALVKALKSDEIKEYIEKTYDGAVIPFE

CDS  cDNA 837 bp
   1 atgaaaaagg taacagcaat tatattaaca gggatcttaa cattaggagt actgacagga    60
  61 tgccaaagta attcaaaagc agaggagaaa ggcagcagtg aagatgcaaa gacgattaaa   120
 121 gtagcagcat ctgcaactcc acacgctgaa atattggaac aggcaaaatc gattctgaaa   180
 181 aaagaaggat atcagctgga agtgacagtg tttgatgact atgtgcagcc aaatgaagtt   240
 241 gtagagagcg gagaatttga tgcaaactat ttccagcatg tgccatatct ggaaagtttc   300
 301 aacgaggaaa aaggaactca tctggtagat gcaggagata tccattatga gccatttgga   360
 361 atttatccag gaacaaaaaa gagtctggat gaaatttccg aaggtgataa aatcgcagtg   420
 421 ccaaatgata cgacaaatga agccagagca ttgcttctct tacaggacaa tggaattatc   480
 481 acattaaaag acggggcagg actcaatgca acagtaaatg atattgaaga aaatccatat   540
 541 aatgtagaaa ttgtagaact ggaagctgca caggtagcaa gagtgaccgg agaaactgca   600
 601 tatgtagtac taaatggaaa ctatgcgctg gaagcaggat attctgtagc caaagatgcg   660
 661 cttgcatatg aaaaatcaga ttctgaggct gcaaaaacat atgtaaacat tattgcagta   720
 721 aaagagggaa atgaaaaaga ggaaaagata caggctcttg taaaggcatt gaaatcagat   780
 781 gagattaaag aatatatcga aaaaacctat gacggagctg tgattccttt tgaataa   837
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu