LOADING...
   ZP_02034978.1;EL13177G
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02034978.1    EL13177G            JCSG 423569 PDB Deposition 14-JAN-21              PDB id: 4oju

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02034978.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides capillosus atcc 29799
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00395; SLH;
DR PDB; 4OJU; Identical; 18-JUN-14; HYPOTHETICAL LEUCINE RICH REPEAT PROTEIN;
DR FFAS; 423503; Fold and function assignment.
DR TVPC; ZP_02034978.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02034978.1; Ortholog view popup.
DR TPM; ZP_02034978.1; Target PDB monitor.
DR FSS; ZP_02034978.1; Target function coverage.
PROPERTY Residues: 622 aa
Molecule Weight: 67042.08 Dalton
Isoelectric Point: 4.64
Extinction Coefficient: 89730
Gravy Index: -.1
Number of Met residues: 9
Percentage of Met residues: 1.45 %
Number of Cys residues: 7
Percentage of Cys residues: 1.13 %
SEQUENCE  amino acids 622 aa
>ZP_02034978.1  gi|154496282|ref|ZP_02034978.1| hypothetical protein BACCAP_00569 [Bacteroides capillosus ATCC 29799
MKKRALSLLLALCLCLSLMPAASASVVESTVQVGPYTFEIWFDGTATLTRYDESLAGSTY
ADIPASVTDENGQEYPVTVIGEKAFEETNITGVTVPDSVISIGRLAFAYCNSLSDVKLSE
NLIYINELAFASCDALKEITIPASVEKMDNPFRWSNALDTVYMEGMVAPEYYFNPYAAYR
EGNGEVVFVIPKGATGYEDWSSRNFVHSVIYEGESVPGYGISLSPSTVDFGTTLTGNDYQ
PEPRVVTVTNSGDRSLVLKLPDDRPDWIFHWESDYSWLGSSARTLEAGESCTFTVEPRPG
RDYGTHSETVTVTTQEGASADLHLSYTVQTPNFRVTVSTEAIDFGAVEVGYAQPAPRSIS
FTNEDDYKISLSGTSELRVEWSKSGFVYSHGHMSARIAPHETVTYTVQPQTGLKPGIYIQ
HVRGNFTSAHIGGDTFQSFDIPVTFIVAAEGDLPSSWAAGQLSQAAAAGIVPESFESRYT
QAATRAEFCALAVRLYEKVTGEAITQRATFSDTTDFNVQKMAGLGVVNGVGGGKFDPGGT
LTREQAATILARLAEAMGHPLPQAAPSFSDSAAISSWAAAGVGQVQAAGIMEGNGSAFIP
QSAYTREQCILTVLRLYQLTQG

CDS  cDNA 1869 bp
   1 atgaaaaagc gcgctctttc cctactgctg gccctgtgcc tgtgcctctc cctcatgccc    60
  61 gccgcctcgg catcggttgt ggaatccacc gtccaggtcg gcccctatac ctttgagata   120
 121 tggttcgacg gcacggccac cctgacccgc tatgacgagt ccctggccgg ctccacctat   180
 181 gcggacatcc ccgcctccgt caccgatgag aacgggcagg agtaccctgt gaccgtcatc   240
 241 ggggaaaagg cctttgagga gacgaacatc accggcgtga ccgtcccgga cagtgtaatc   300
 301 tcgattggaa ggttagcgtt tgcttattgc aactccctgt ccgacgtcaa actgagtgaa   360
 361 aaccttatct acatcaacga acttgccttc gcaagctgcg acgccctgaa agagattacc   420
 421 atccccgcca gcgtggagaa gatggataat ccctttagat ggagcaacgc gctggatacc   480
 481 gtctatatgg agggtatggt agcccccgag tactatttca atccctacgc cgcctaccgc   540
 541 gagggcaacg gtgaggtcgt ttttgtcatc cccaaagggg ctaccggcta tgaagactgg   600
 601 tcctcacgga acttcgtcca ctccgtcatc tatgagggag aatccgtccc cggatacggc   660
 661 atctctctga gtccctccac cgtggacttc ggcaccactc tcacaggaaa tgactatcag   720
 721 ccggaaccca gggttgtcac cgtcaccaac agcggcgaca ggtcactcgt tctgaaactg   780
 781 cctgacgatc gccccgattg gatattccac tgggagagcg actacagctg gctcggttcg   840
 841 agcgccagaa ctctggaagc cggagagagc tgtaccttta ccgtggaacc cagacccggg   900
 901 cgcgactatg gaacacacag cgagaccgtc accgtcacca cccaggaggg agccagcgcc   960
 961 gacctgcatc tgtcctatac cgtgcagact ccgaatttcc gggtgactgt gagcacggag  1020
1021 gccatagact tcggtgcggt ggaggtggga tacgcccagc ccgctccccg cagcatctcc  1080
1081 ttcaccaacg aggacgacta taaaatcagc ctgagcggga cgtccgaatt aagggttgag  1140
1141 tggagcaaga gcgggttcgt ctattcgcac gggcacatga gcgcacgcat cgcgccccac  1200
1201 gagaccgtca cctataccgt gcagccccag accggcctga agcccggtat ctatatccaa  1260
1261 catgtacggg gcaacttcac cagcgcccat attggcgggg atacgttcca gtctttcgat  1320
1321 atcccggtga ccttcatcgt ggcggcggaa ggggacctgc cctcctcctg ggccgcggga  1380
1381 cagctcagcc aggccgccgc cgccggcatt gtgcccgaga gcttcgagag ccggtacacc  1440
1441 caggccgcca cccgggccga gttctgcgcc ctggcggtga ggctctacga gaaggtgacc  1500
1501 ggcgaggcca tcacccagcg ggccacattc tccgacacca ccgacttcaa cgtccagaag  1560
1561 atggccggtc tgggcgtggt caacggcgtg ggcggcggaa aatttgaccc cggcggcacc  1620
1621 ctgacccggg agcaggcggc caccatcctg gcccgcctgg cagaggccat gggccatccc  1680
1681 ctgccccagg cggctcccag cttctcagac agcgccgcca tctcctcctg ggccgccgcc  1740
1741 ggggtgggac aggtccaggc cgccgggatt atggagggga acggcagcgc cttcatcccc  1800
1801 cagagcgcct acaccaggga gcagtgcatc ctcaccgtcc tgcggctgta tcagctgacc  1860
1861 cagggctga  1869
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu