LOADING...
   ZP_02034084.1;SP13427B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02034084.1    SP13427B            JCSG 419228 PDB Deposition 15-MAR-11              PDB id: 4yok

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02034084.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMParabacteroides merdae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4YOK; Identical; 25-MAR-15; PUTATIVE FLAGELLAR PROTEIN FLIS;
DR PDB; 3HN5; Highly similar; 23-JUN-09; PUTATIVE EXPORTED PROTEIN BF0290;
DR PDB; 4FXT; Highly similar; 25-JUL-12; UNCHARACTERIZED PROTEIN;
DR FFAS; 412933; Fold and function assignment.
DR TVPC; ZP_02034084.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02034084.1; Ortholog view popup.
DR TPM; ZP_02034084.1; Target PDB monitor.
DR FSS; ZP_02034084.1; Target function coverage.
PROPERTY Residues: 226 aa
Molecule Weight: 24705.79 Dalton
Isoelectric Point: 5.2
Extinction Coefficient: 17420
Gravy Index: -.01
Number of Met residues: 6
Percentage of Met residues: 2.65 %
Number of Cys residues: 1
Percentage of Cys residues: 0.44 %
SEQUENCE  amino acids 226 aa
>ZP_02034084.1  gi|154495079|ref|ZP_02034084.1| hypothetical protein PARMER_04126 [Parabacteroides merdae ATCC 43184
MSMKIISNIFSVILLLVLFSGCGKDNFDAPESKLVGRVTYQGQALNLRGTGEAVQLQLYQ
DGYEKNDPISVFVGQDGTFSALLFDGEYRLTTRDGNGPWVNNHESVTVNLKGHTEVNLEV
TPYFMISNEQLSVTGSAMNASFMINRIVPDAKISRVMLLLSKTQFADDVNNLYRQDFSDV
VPGSVNLSADISGNTEIVKAKALYARVGVLANGADQAIYSPVVRLK

CDS  cDNA 681 bp
   1 atgagtatga agattatatc taatattttt tcggtaattt tactgctggt attgttttcc    60
  61 ggctgtggaa aagataattt tgatgcgccg gaatccaaac tggttggtag agttacttat   120
 121 cagggacagg ctttgaactt gcgtggaacc ggcgaagcag tccagttgca gttgtatcag   180
 181 gatggttatg agaagaatga tccgatttct gtttttgtag gacaagatgg tactttctcc   240
 241 gctcttttgt ttgatggtga atatcgtttg acgacaagag acgggaacgg accgtgggtg   300
 301 aataatcatg agtccgtaac cgtgaatttg aaaggacata cggaagtgaa tctggaagtt   360
 361 actccgtatt ttatgatttc gaacgaacaa ttgtctgtta cgggatcggc aatgaacgcg   420
 421 tcgtttatga ttaacaggat tgtgccggat gcgaagatca gtcgggtgat gttgttatta   480
 481 agcaagacgc aatttgcgga tgatgtcaac aacttgtacc gtcaggactt ctcggatgtc   540
 541 gttcccggta gcgtgaatct ttctgccgat attagcggta ataccgaaat agtaaaggca   600
 601 aaagcccttt acgctcgtgt cggtgttttg gctaacggag cggatcaggc tatctattcg   660
 661 ccagtggttc ggttgaagtg a   681
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu