LOADING...
   ZP_02033777.1;SP13833A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02033777.1    SP13833A            JCSG 419132 PDB Deposition 14-AUG-28              PDB id: 4r7s

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02033777.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMParabacteroides merdae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00515; TPR_1;
DR PDB; 4R7S; Identical; 01-OCT-14; TETRATRICOPEPTIDE REPEAT PROTEIN;
DR FFAS; 412747; Fold and function assignment.
DR TVPC; ZP_02033777.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02033777.1; Ortholog view popup.
DR TPM; ZP_02033777.1; Target PDB monitor.
DR FSS; ZP_02033777.1; Target function coverage.
PROPERTY Residues: 275 aa
Molecule Weight: 31819.76 Dalton
Isoelectric Point: 5.38
Extinction Coefficient: 34840
Gravy Index: -.39
Number of Met residues: 10
Percentage of Met residues: 3.64 %
Number of Cys residues: 1
Percentage of Cys residues: 0.36 %
SEQUENCE  amino acids 275 aa
>ZP_02033777.1  gi|154494457|ref|ZP_02033777.1| hypothetical protein PARMER_03812 [Parabacteroides merdae ATCC 43184
MRTFLIIIGLFLFIGNSFAQSYEELIEKSYDFVDKGDLVSAEESLKAAMRKEPANPLNYA
LLTNLGTIQRRQGKLQEALISYTSALSGHTKNITILENRASLYTELGETEKALNDYNTLL
IENPEHQEALYCRGLLYIQLQNYMWAEQDFDKILEVNEKSVRARLGHAILEKMRGNYDES
ERIFNYLISEMPRDWILYEGRADLYFMMGKNARAMADIEKVFTESEPTANLYVLRGKIKL
AQYEKERAALDFKKAESMGYNKEVIKELLKLTMNN

CDS  cDNA 828 bp
   1 atgaggactt tcttgattat tataggtttg ttcctgttta taggaaacag ctttgcacaa    60
  61 tcatacgaag aattaataga gaaaagctac gacttcgtag ataaaggcga tttggtgtcc   120
 121 gcagaagaga gcctgaaagc ggccatgcgc aaagaaccgg ctaacccgtt gaactatgcc   180
 181 ttgcttacga acctcggaac catacagcgc cgacagggga agctgcaaga ggctctcatc   240
 241 tcctacactt ccgcactaag cgggcataca aagaacatca ccattctcga aaaccgggct   300
 301 tccctttata cagaattggg agaaacagaa aaagctttga acgattacaa caccttgtta   360
 361 atagaaaatc cggaacatca ggaggcgctt tattgccgag ggctgctcta tatacagtta   420
 421 caaaattata tgtgggcaga acaggatttc gacaaaattc tggaagtaaa cgagaaatcg   480
 481 gttcgtgctc gcctcggcca tgccatcttg gaaaagatgc gtgggaacta cgacgagagc   540
 541 gaacggatat tcaattacct gattagcgag atgccccgcg actggatcct ctacgaagga   600
 601 cgggcggatt tgtattttat gatgggaaaa aatgcacggg caatggcaga tatagaaaaa   660
 661 gtctttaccg aaagcgaacc gacagccaac ctctatgtgt tgagaggcaa gatcaagctg   720
 721 gcacaatacg aaaaggagcg ggcagccctc gatttcaaga aagcagaatc aatgggatac   780
 781 aataaagaag ttatcaagga acttcttaaa ttgacaatga acaattga   828
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu